SPMIP9 (sperm microtubule inner protein 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 200523
Gene name Sperm microtubule inner protein 9
Gene symbol SPMIP9
Synonyms (NCBI Gene)
C2orf51TEX37TSC21
Chromosome 2
Chromosome location 2p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 26168773
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619676 26341 ENSG00000172073
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LM6
Protein name Protein SPMIP9 (Sperm microtubule inner protein 9) (Testis-expressed sequence 37 protein) (Testis-specific conserved protein of 21 kDa)
Protein function Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in flagella axoneme.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15217 TSC21 1 → 180 TSC21 family Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific (PubMed:17091336, PubMed:26168773). Detected in the germ cell lineage at all stages (PubMed:26168773). {ECO:0000269|PubMed:17091336, ECO:0000269|PubMed:26168773}.
Sequence 
MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNP
NPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQ
GDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ
Sequence length 180
Interactions View interactions

No strongly related genes found yet for SPMIP9.

No additional diseases found yet through genes similar to SPMIP9.