SPMIP6 (sperm microtubule inner protein 6)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84688
• Gene name: Sperm microtubule inner protein 6
• Gene symbol: SPMIP6
• Synonyms (NCBI Gene): C9orf24, CBE1, NYD-SP22, SMRP1, bA573M23.4
• Chromosome: 9
• Chromosome location: 9p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018013	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002177	Component	Manchette	IBA
GO:0002177	Component	Manchette	IEA
GO:0002177	Component	Manchette	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	15242845
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IBA
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15242845
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0097225	Component	Sperm midpiece	IEA
GO:0097225	Component	Sperm midpiece	ISS
GO:0160111	Component	Axonemal A tubule inner sheath	IEA

Other IDs

• MIM: 619502
• HGNC: 19919
• e!Ensembl: ENSG00000164972

Protein

• UniProt ID: Q8NCR6
• Protein name: Sperm microtubule inner protein 6 (Ciliated bronchial epithelial protein 1) (Spermatid-specific manchette-related protein 1) (Testis development protein NYD-SP22)
• Protein function: May participate in intramanchette transport and midpiece formation of the sperm tail. May play a potential role in somatic cell proliferation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15181	SMRP1	1 → 262	Spermatid-specific manchette-related protein 1	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis (PubMed:28601408). Strongly expressed in ciliated epithelial cells with lower levels in goblet cells (at protein level) (PubMed:15242845). {ECO:0000269|PubMed:15242845, ECO:0000269|PubMed:28601408}.
• Sequence:

  MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEAL
  QKMAKCAVQDYTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCC
  NKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITP
  RCGCVDPLPGRLPFHGYESACSGRHYCLRGMDYYASGAPCTDRRLRPWCREQPTMCTSLR
  APARNAVCCYNSPAVILPISEP

• Sequence length: 262

Related Genes

No strongly related genes found yet for SPMIP6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPMIP6.