SPINT4 (serine peptidase inhibitor, Kunitz type 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 391253
Gene name Serine peptidase inhibitor, Kunitz type 4
Gene symbol SPINT4
Synonyms (NCBI Gene)
C20orf137SPINT3dJ601O1.1
Chromosome 20
Chromosome location 20q13.12
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019250 hsa-miR-148b-3p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0030414 Function Peptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619430 16130 ENSG00000149651
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UDR6
Protein name Kunitz-type protease inhibitor 4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00014 Kunitz_BPTI 40 → 92 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
Sequence 
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYN
RTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR
Sequence length 99
Interactions View interactions

No strongly related genes found yet for SPINT4.

No additional diseases found yet through genes similar to SPINT4.