SPINK7 (serine peptidase inhibitor Kazal type 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84651
Gene name Serine peptidase inhibitor Kazal type 7
Gene symbol SPINK7
Synonyms (NCBI Gene)
ECG2ECRG2
Chromosome 5
Chromosome location 5q32
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019104 hsa-miR-335-5p Microarray 18185580
MIRT1384466 hsa-miR-3192 CLIP-seq
MIRT1384467 hsa-miR-4314 CLIP-seq
MIRT1384468 hsa-miR-4646-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 12646258, 12970870
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
GO:0006954 Process Inflammatory response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617288 24643 ENSG00000145879
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P58062
Protein name Serine protease inhibitor Kazal-type 7 (Esophagus cancer-related gene 2 protein) (ECRG-2)
Protein function Probable serine protease inhibitor.
PDB 2LEO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00050 Kazal_1 32 → 85 Kazal-type serine protease inhibitor domain Domain
Sequence 
MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGSC
Sequence length 85
Interactions View interactions

No strongly related genes found yet for SPINK7.

No additional diseases found yet through genes similar to SPINK7.