SPINK6 (serine peptidase inhibitor Kazal type 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 404203
Gene name Serine peptidase inhibitor Kazal type 6
Gene symbol SPINK6
Synonyms (NCBI Gene)
BUSI2UNQ844
Chromosome 5
Chromosome location 5q32
Summary The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene. [provided by RefSeq, Aug 2010]
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1384456 hsa-miR-224 CLIP-seq
MIRT1384457 hsa-miR-31 CLIP-seq
MIRT1384458 hsa-miR-3128 CLIP-seq
MIRT1384459 hsa-miR-320a CLIP-seq
MIRT1384460 hsa-miR-320b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0030414 Function Peptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615868 29486 ENSG00000178172
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWN8
Protein name Serine protease inhibitor Kazal-type 6 (Kallikrein inhibitor)
Protein function Serine protease inhibitor selective for kallikreins. Efficiently inhibits KLK4, KLK5, KLK6, KLK7, KLK12, KLK13 and KLK14. Doesn't inhibit KLK8.
PDB 2N52
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00050 Kazal_1 30 → 80 Kazal-type serine protease inhibitor domain Domain
Sequence 
MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA
FCKAIVKSGGKISLKHPGKC
Sequence length 80
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Formation of the cornified envelope

No strongly related genes found yet for SPINK6.

No additional diseases found yet through genes similar to SPINK6.