SPINK14 (serine peptidase inhibitor Kazal type 14 (putative))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 408187
Gene name Serine peptidase inhibitor Kazal type 14 (putative)
Gene symbol SPINK14
Synonyms (NCBI Gene)
SPINK5L2
Chromosome 5
Chromosome location 5q32
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0030414 Function Peptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6IE38
Protein name Serine protease inhibitor Kazal-type 14
Protein function May be a serine protease inhibitor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00050 Kazal_1 40 → 97 Kazal-type serine protease inhibitor domain Domain
Sequence 
MAKSFPVFSLLSFILIHLVLSSVSGPRHWWPPRGIIKVKCPYEKVNLSWYNGTVNPCPGL
YQPICGTNFITYDNPCILCVESLKSHGRIRFYHDGKC
Sequence length 97
Interactions View interactions

No strongly related genes found yet for SPINK14.

No additional diseases found yet through genes similar to SPINK14.