SPINK13 (serine peptidase inhibitor Kazal type 13)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 153218
Gene name Serine peptidase inhibitor Kazal type 13
Gene symbol SPINK13
Synonyms (NCBI Gene)
HBVDNAPTP1HESPINTORLiESP6SPINK5L3
Chromosome 5
Chromosome location 5q32
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1384447 hsa-miR-205 CLIP-seq
MIRT1384448 hsa-miR-579 CLIP-seq
MIRT1384449 hsa-miR-593 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005576 Component Extracellular region IEA
GO:0030414 Function Peptidase inhibitor activity IEA
GO:1902225 Process Negative regulation of acrosome reaction ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615205 27200 ENSG00000214510
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q1W4C9
Protein name Serine protease inhibitor Kazal-type 13 (Hepatitis B virus DNA polymerase transactivated serine protease inhibitor) (Hespintor) (Serine protease inhibitor Kazal-type 5-like 3)
Protein function May be a serine protease inhibitor (By similarity). Essential for sperm maturation and fertility. Inhibits sperm acrosome reaction, protecting sperm from premature reaction (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00050 Kazal_1 46 → 93 Kazal-type serine protease inhibitor domain Domain
Sequence 
MAAFPHKIIFFLVCSTLTHVAFSGIFNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPV
CASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD
Sequence length 94
Interactions View interactions

No strongly related genes found yet for SPINK13.

No additional diseases found yet through genes similar to SPINK13.