SPIN2B (spindlin family member 2B)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 474343
• Gene name: Spindlin family member 2B
• Gene symbol: SPIN2B
• Synonyms (NCBI Gene): SPIN-2, SPIN-2B, SPIN2_duplicate, TDRD26, dJ323P24.2
• Chromosome: X
• Chromosome location: Xp11.21

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1384265	hsa-miR-1283	CLIP-seq
MIRT1384266	hsa-miR-129-5p	CLIP-seq
MIRT1384267	hsa-miR-3618	CLIP-seq
MIRT1384268	hsa-miR-450b-5p	CLIP-seq
MIRT1384269	hsa-miR-4789-5p	CLIP-seq
MIRT1384270	hsa-miR-507	CLIP-seq
MIRT1384271	hsa-miR-557	CLIP-seq
MIRT1384272	hsa-miR-934	CLIP-seq
MIRT1384273	hsa-miR-1227	CLIP-seq
MIRT1384265	hsa-miR-1283	CLIP-seq
MIRT1384266	hsa-miR-129-5p	CLIP-seq
MIRT1384267	hsa-miR-3618	CLIP-seq
MIRT1384274	hsa-miR-3692	CLIP-seq
MIRT1384268	hsa-miR-450b-5p	CLIP-seq
MIRT1384275	hsa-miR-455-5p	CLIP-seq
MIRT1384276	hsa-miR-4643	CLIP-seq
MIRT1384277	hsa-miR-4766-5p	CLIP-seq
MIRT1384269	hsa-miR-4789-5p	CLIP-seq
MIRT1384278	hsa-miR-488	CLIP-seq
MIRT1384270	hsa-miR-507	CLIP-seq
MIRT1384279	hsa-miR-548an	CLIP-seq
MIRT1384271	hsa-miR-557	CLIP-seq
MIRT1384272	hsa-miR-934	CLIP-seq
MIRT2337698	hsa-miR-361-5p	CLIP-seq
MIRT2337699	hsa-miR-4270	CLIP-seq
MIRT2337700	hsa-miR-4441	CLIP-seq
MIRT2337701	hsa-miR-587	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	29061846, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007276	Process	Gamete generation	IEA
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	29061846

Other IDs

• MIM: 300517
• HGNC: 33147
• e!Ensembl: ENSG00000186787

Protein

• UniProt ID: Q9BPZ2
• Protein name: Spindlin-2B (Spindlin-like protein 2B) (SPIN-2) (SPIN-2B)
• Protein function: Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846). {ECO:0000269|
• PDB: 5LUG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02513	Spin-Ssty	50 → 99	Spin/Ssty Family	Repeat
  PF02513	Spin-Ssty	129 → 178	Spin/Ssty Family	Repeat
  PF02513	Spin-Ssty	210 → 255	Spin/Ssty Family	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Detected in all the examined tissues with highest expression in liver, followed by heart, stomach, kidney, skeletal muscle, placenta, and pancreas.
• Sequence:

  MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKE
  GDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHIS
  DANLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDD
  YKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVEAKPSVYF
  IKFDDDFHIYVYDLVKKS

• Sequence length: 258

Related Genes

No strongly related genes found yet for SPIN2B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPIN2B.