SPESP1 (sperm equatorial segment protein 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 246777
• Gene name: Sperm equatorial segment protein 1
• Gene symbol: SPESP1
• Synonyms (NCBI Gene): ESP, SP-ESP
• Chromosome: 15
• Chromosome location: 15q23
• Summary: The encoded protein is a human alloantigen involved in sperm-egg binding and fusion. [provided by RefSeq, Apr 2010]

miRNA Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2631121	hsa-miR-1271	CLIP-seq
MIRT2631122	hsa-miR-300	CLIP-seq
MIRT2631123	hsa-miR-338-5p	CLIP-seq
MIRT2631124	hsa-miR-3545-3p	CLIP-seq
MIRT2631125	hsa-miR-381	CLIP-seq
MIRT2631126	hsa-miR-4666-3p	CLIP-seq
MIRT2631127	hsa-miR-4781-3p	CLIP-seq
MIRT2631128	hsa-miR-4789-3p	CLIP-seq
MIRT2631129	hsa-miR-4789-5p	CLIP-seq
MIRT2631130	hsa-miR-642b	CLIP-seq
MIRT2631131	hsa-miR-96	CLIP-seq
MIRT2631121	hsa-miR-1271	CLIP-seq
MIRT2631123	hsa-miR-338-5p	CLIP-seq
MIRT2631124	hsa-miR-3545-3p	CLIP-seq
MIRT2631127	hsa-miR-4781-3p	CLIP-seq
MIRT2631128	hsa-miR-4789-3p	CLIP-seq
MIRT2631129	hsa-miR-4789-5p	CLIP-seq
MIRT2631130	hsa-miR-642b	CLIP-seq
MIRT2631131	hsa-miR-96	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0007340	Process	Acrosome reaction	IBA
GO:0007340	Process	Acrosome reaction	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0009566	Process	Fertilization	ISS
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035036	Process	Sperm-egg recognition	ISS
GO:0045171	Component	Intercellular bridge	IDA
GO:0072686	Component	Mitotic spindle	IDA

Other IDs

• MIM: 609399
• HGNC: 15570
• e!Ensembl: ENSG00000258484

Protein

• UniProt ID: Q6UW49
• Protein name: Sperm equatorial segment protein 1 (SP-ESP) (Equatorial segment protein) (ESP) (Glycosylated 38 kDa sperm protein C-7/8)
• Protein function: Involved in fertilization ability of sperm.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15754	SPESP1	20 → 338	Sperm equatorial segment protein 1	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis, where it is localized in the acrosome of postmeiotic stages of spermiogenesis (round and elongating spermatids and in ejaculated spermatozoa) (at protein level). Poorly expressed in placenta and fetal lung.
• Sequence:

  MKPLVLLVALLLWPSSVPAYPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNS
  PKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTGGFTPEIGKKKHTESTP
  FWSIKPNNVSIVLHAEEPYIENEEPEPEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSP
  VTTLDKSTGIGISTESEDVPQLSGETAIEKPEEFGKHPESWNNDDILKKILDINSQVQQA
  LLSDTSNPAYREDIEASKDHLKRSLALAAAAEHKLKTMYKSQLLPVGRTSNKIDDIETVI
  NMLCNSRSKLYEYLDIKCVPPEMREKAATVFNTLKNMCRSRRVTALLKVY

• Sequence length: 350

Related Genes

No strongly related genes found yet for SPESP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPESP1.