SPEF1 (sperm flagellar 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 25876
• Gene name: Sperm flagellar 1
• Gene symbol: SPEF1
• Synonyms (NCBI Gene): C20orf28, CLAMP, SPEF1A
• Chromosome: 20
• Chromosome location: 20p13

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1383673	hsa-miR-3173-3p	CLIP-seq
MIRT1383674	hsa-miR-3181	CLIP-seq
MIRT1383675	hsa-miR-3616-3p	CLIP-seq
MIRT1383676	hsa-miR-4476	CLIP-seq
MIRT1383677	hsa-miR-4533	CLIP-seq
MIRT1383678	hsa-miR-4733-5p	CLIP-seq
MIRT2337566	hsa-miR-4314	CLIP-seq

Gene ontology (GO) Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0001578	Process	Microtubule bundle formation	ISS
GO:0001725	Component	Stress fiber	IEA
GO:0003341	Process	Cilium movement	IEA
GO:0003341	Process	Cilium movement	ISS
GO:0003779	Function	Actin binding	IDA	31473225
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31473225, 32296183
GO:0005737	Component	Cytoplasm	IDA	31473225
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	31473225
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IDA	31473225
GO:0005902	Component	Microvillus	IEA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IBA
GO:0005930	Component	Axoneme	ISS
GO:0007026	Process	Negative regulation of microtubule depolymerization	IEA
GO:0007026	Process	Negative regulation of microtubule depolymerization	ISS
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	31473225
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	31473225
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016477	Process	Cell migration	ISS
GO:0030027	Component	Lamellipodium	IDA	31473225
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030032	Process	Lamellipodium assembly	IMP	31473225
GO:0030175	Component	Filopodium	IDA	31473225
GO:0030175	Component	Filopodium	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046847	Process	Filopodium assembly	IMP	31473225
GO:0051493	Process	Regulation of cytoskeleton organization	IBA
GO:0097542	Component	Ciliary tip	IEA
GO:0097542	Component	Ciliary tip	ISS
GO:0097729	Component	9+2 motile cilium	IEA
GO:0097729	Component	9+2 motile cilium	ISS
GO:0120025	Component	Plasma membrane bounded cell projection	IEA
GO:1904158	Process	Axonemal central apparatus assembly	IEA
GO:1904158	Process	Axonemal central apparatus assembly	ISS
GO:1990716	Component	Axonemal central apparatus	IEA
GO:1990716	Component	Axonemal central apparatus	ISS
GO:2000095	Process	Regulation of Wnt signaling pathway, planar cell polarity pathway	ISS

Other IDs

• MIM: 610674
• HGNC: 15874
• e!Ensembl: ENSG00000101222

Protein

• UniProt ID: Q9Y4P9
• Protein name: Sperm flagellar protein 1
• Protein function: Microtubule-associated protein involved in the stabilization of microtubules along the axis of migration during radial intercalation. Promotes the establishment and stabilization of an axis of microtubules required for the active migration of ce
• PDB: 2EE7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06294	CH_2	13 → 109	CH-like domain in sperm protein	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the intestinal epithelial cells (at protein level). {ECO:0000269|PubMed:31473225}.
• Sequence:

  MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
  SLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQ
  GAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDP
  SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR

• Sequence length: 236

Related Genes

No strongly related genes found yet for SPEF1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPEF1.