SPDYE7P (speedy/RINGO cell cycle regulator family member E7, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 441251
Gene name Speedy/RINGO cell cycle regulator family member E7, pseudogene
Gene symbol SPDYE7P
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0019901 Function Protein kinase binding IBA
GO:0019901 Function Protein kinase binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 35466 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q495Y7
Protein name Putative speedy protein E7 (Speedy protein E7 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11357 Spy1 50 → 163 Cell cycle regulatory protein Family
PF11357 Spy1 155 → 204 Cell cycle regulatory protein Family
Sequence 
MEWWDKSEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLE
DPVIKRFLAWDKGLRVSDKYLLAMVIVYFSRAGLPSWQYQCIHFFLALYLANDMEEDDED
PKQNIFYFLYGKTRSRIPLLRKRRFQLCRCMNPRARKNRSQIVLFQKLRFQFFCSMSCRA
WVSPEELEEIQAYDPEHWVWARDRARLS
Sequence length 208
Interactions View interactions

No strongly related genes found yet for SPDYE7P.

No additional diseases found yet through genes similar to SPDYE7P.