SPATA8 (spermatogenesis associated 8)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 145946
Gene name Spermatogenesis associated 8
Gene symbol SPATA8
Synonyms (NCBI Gene)
SRG8
Chromosome 15
Chromosome location 15q26.2
miRNA miRNA information provided by mirtarbase database.
12 Show/Hide all (12)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1382790 hsa-miR-1206 CLIP-seq
MIRT1382791 hsa-miR-1285 CLIP-seq
MIRT1382792 hsa-miR-3117-5p CLIP-seq
MIRT1382793 hsa-miR-3123 CLIP-seq
MIRT1382794 hsa-miR-3127-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21516116, 25416956, 32296183, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
613948 28676 ENSG00000185594
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6RVD6
Protein name Spermatogenesis-associated protein 8 (Spermatogenesis-related protein 8)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in adult testis, at moderate levels in sperm and at low levels in fetal testis. Not detected in other tissues. {ECO:0000269|PubMed:16809841}.
Sequence 
MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPV
WPAKEENSCSHGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS
Sequence length 105
Interactions View interactions

No strongly related genes found yet for SPATA8.

No additional diseases found yet through genes similar to SPATA8.