SPATA46 (spermatogenesis associated 46)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284680
Gene name Spermatogenesis associated 46
Gene symbol SPATA46
Synonyms (NCBI Gene)
C1orf111HSD20TEKT2BP2
Chromosome 1
Chromosome location 1q23.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0007283 Process Spermatogenesis IEA
GO:0007283 Process Spermatogenesis ISS
GO:0007342 Process Fusion of sperm to egg plasma membrane involved in single fertilization IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617257 27648 ENSG00000171722
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T0L3
Protein name Spermatogenesis-associated protein 46
Protein function Plays a role in spermiogenesis and fertilization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17734 Spt46 1 → 225 Spermatogenesis-associated protein 46 Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific (PubMed:27488028). {ECO:0000269|PubMed:27488028}.
Sequence 
MENFSLLSISGPPISSSALSAFPDIMFSRATSLPDIAKTAVPTEASSPAQALPPQYQSII
VRQGIQNTALSPDCSLGDTQHGEKLRRNCTIYRPWFSPYSYFVCADKESQLEAYDFPEVQ
QDEGKWDNCLSEDMAENICSSSSSPENTCPREATKKSRHGLDSITSQDILMASRWHPAQQ
NGYKCVACCRMYPTLDFLKSHIKRGFREGFSCKVYYRKLKALWSKEQKARLGDRLSSGSC
QAFNSPAEHLRQIGGEAYLCL
Sequence length 261
Interactions View interactions

No strongly related genes found yet for SPATA46.

No additional diseases found yet through genes similar to SPATA46.