SPATA4 (spermatogenesis associated 4)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 132851
Gene name Spermatogenesis associated 4
Gene symbol SPATA4
Synonyms (NCBI Gene)
CFAP178FAP178SPEF1BTSARG2
Chromosome 4
Chromosome location 4q34.2
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2337383 hsa-miR-330-3p CLIP-seq
MIRT2337384 hsa-miR-4778-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609879 17333 ENSG00000150628
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEY3
Protein name Spermatogenesis-associated protein 4 (Testis and spermatogenesis cell-related protein 2) (Testis spermatocyte apoptosis-related gene 2 protein)
Protein function May play a role in apoptosis regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06294 CH_2 55 → 150 CH-like domain in sperm protein Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis, the expression is observed precisely in seminiferous tubules. {ECO:0000269|PubMed:15158438}.
Sequence 
MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQ
GLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLAR
KKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVS
RSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
MDKKP
Sequence length 305
Interactions View interactions

No strongly related genes found yet for SPATA4.

No additional diseases found yet through genes similar to SPATA4.