SPATA25 (spermatogenesis associated 25)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 128497
Gene name Spermatogenesis associated 25
Gene symbol SPATA25
Synonyms (NCBI Gene)
C20orf165TSG23dJ337O18.8
Chromosome 20
Chromosome location 20q13.12
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0007283 Process Spermatogenesis IBA
GO:0007283 Process Spermatogenesis IEA
GO:0007283 Process Spermatogenesis IEP 19240080
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618936 16158 ENSG00000149634
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BR10
Protein name Spermatogenesis-associated protein 25 (Testis-specific gene 23 protein)
Protein function May play a role in spermatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15218 SPATA25 1 → 227 Spermatogenesis-associated protein 25 Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in testis (at protein level). Expression is lower in patients with obstructive azoospermia than in fertile controls and is not detected in patients with non-obstructive azoospermia. {ECO:0000269|PubMed:19240080}
Sequence 
MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQA
WGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPS
RPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWA
AQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL
Sequence length 227
Interactions View interactions

No strongly related genes found yet for SPATA25.

No additional diseases found yet through genes similar to SPATA25.