SPANXN2 (SPANX family member N2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 494119
Gene name SPANX family member N2
Gene symbol SPANXN2
Synonyms (NCBI Gene)
CT11.7SPANX-N2
Chromosome X
Chromosome location Xq27.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300665 33175 ENSG00000268988
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5MJ10
Protein name Sperm protein associated with the nucleus on the X chromosome N2 (Nuclear-associated protein SPAN-Xn2) (SPANX-N2) (SPANX family member N2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07458 SPAN-X 1 → 95 Sperm protein associated with nucleus, mapped to X chromosome Family
Sequence 
MEQPTSSTNGEKRKSPCESNNKKNDEMQEAPNRVLAPKQSLQKTKTIEYLTIIVYYYRKH
TKINSNQLEKDQSRENSINPVQEEEDEGLDSAEGSSQEDEDLDSSEGSSQEDEDLDSSEG
SSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDEDLDPPEGSSQEDEDLDSSEGSSQEGGED
Sequence length 180
Interactions View interactions

No strongly related genes found yet for SPANXN2.

No additional diseases found yet through genes similar to SPANXN2.