SPANXC (SPANX family member C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 64663
Gene name SPANX family member C
Gene symbol SPANXC
Synonyms (NCBI Gene)
CT11.3CTp11SPANX-CSPANX-ESPANXE
Chromosome X
Chromosome location Xq27.2
Summary Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a m
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32814053
GO:0005634 Component Nucleus HDA 21630459
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 10626816
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300330 14331 ENSG00000198573
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NY87
Protein name Sperm protein associated with the nucleus on the X chromosome C (Cancer/testis antigen 11.3) (CT11.3) (Cancer/testis-associated protein CTp11) (Nuclear-associated protein SPAN-Xc) (SPANX-C) (SPANX family member C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07458 SPAN-X 1 → 94 Sperm protein associated with nucleus, mapped to X chromosome Family
Tissue specificity TISSUE SPECIFICITY: Detected in testis, melanoma and bladder carcinoma. {ECO:0000269|PubMed:10626816, ECO:0000269|PubMed:12758128}.
Sequence 
MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVK
RTSPEELVNDHARENRINPLQMEEEEFMEIMVEIPAK
Sequence length 97
Interactions View interactions

No strongly related genes found yet for SPANXC.

No additional diseases found yet through genes similar to SPANXC.