SPANXA2-OT1 (SPANXA2 overlapping transcript 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 619455 |
| Gene name | SPANXA2 overlapping transcript 1 |
| Gene symbol | SPANXA2-OT1 |
| Synonyms (NCBI Gene) |
CXorf18
|
| Chromosome | X |
| Chromosome location | Xq27.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8N9U9 |
| Protein name | Putative uncharacterized protein SPANXA2-OT1 |
| Family and domains | |
| Sequence |
MASPFGRLTDQKGRGHPAGSGGVEVNGGSARAAFSGGGRRVLSGGGRTAFGGGGRTAFGD |
| Sequence length | 137 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SPANXA2-OT1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SPANXA2-OT1 (see Related Genes above), that are NOT already directly curated for SPANXA2-OT1 itself -- a lead worth checking, not a confirmed association.
0
|
|