Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	402573
Gene name	Sperm acrosome developmental regulator
Gene symbol	SPACDR
Synonyms (NCBI Gene)	C7orf61
Chromosome	7
Chromosome location	7q22.1

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IDA	31429579, 31985809
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IMP	31985809
GO:0030154	Process	Cell differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA

MIM	HGNC	e!Ensembl
619782	22135	ENSG00000185955

Q8IZ16

Protein name

Sperm acrosome developmental regulator

Protein function

May play a role in acrosome formation and nucleus shaping during spermiogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15775	DUF4703	22 → 206	Domain of unknown function (DUF4703)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in sperm (at protein level). {ECO:0000269|PubMed:23634713}.

Sequence

MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLV
ELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQ
SGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHR
RHHVRCHAAPRPNPAQSLKLDAQSPL

Sequence length

206

Interactions

View interactions

Related Genes Genes most often co-reported with SPACDR across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SPACDR.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SPACDR (see Related Genes above), that are NOT already directly curated for SPACDR itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SPACDR.

SPACDR (sperm acrosome developmental regulator)

Save This Analysis