SPACA9 (sperm acrosome associated 9)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 11092
• Gene name: Sperm acrosome associated 9
• Gene symbol: SPACA9
• Synonyms (NCBI Gene): C9orf9, Mast
• Chromosome: 9
• Chromosome location: 9q34.13

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IDA	28282151
GO:0008017	Function	Microtubule binding	IDA	36191189
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0035082	Process	Axoneme assembly	IDA	36191189
GO:0036064	Component	Ciliary basal body	IEA
GO:0036064	Component	Ciliary basal body	ISS
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0097546	Component	Ciliary base	IBA
GO:0097546	Component	Ciliary base	IEA
GO:0160110	Component	Axonemal microtubule doublet inner sheath	IEA
GO:0160110	Component	Axonemal microtubule doublet inner sheath	ISS

Other IDs

• MIM: 618552
• HGNC: 1367
• e!Ensembl: ENSG00000165698

Protein

• UniProt ID: Q96E40
• Protein name: Sperm acrosome-associated protein 9
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) of multiciliated respiratory cells and the distal singlet microtubules of monoflagellated spermatozoa (PubMed:36191189). Forms an extensive interaction netw
• PDB: 7UN1 , 7UNG , 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15120	SPACA9	2 → 165	Sperm acrosome-associated protein 9	Family

• Sequence:

  MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSS
  TDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHD
  VVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAA
  RPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL

• Sequence length: 222

Related Genes

No strongly related genes found yet for SPACA9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SPACA9.