SPACA6 (sperm acrosome associated 6) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	147650
Gene name	Sperm acrosome associated 6
Gene symbol	SPACA6
Synonyms (NCBI Gene)	LET7EHLINC00085NCRNA00085SPACA6P
Chromosome	19
Chromosome location	19q13.41

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005886	Component	Plasma membrane	IDA	39423812
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	ISS
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	39423812
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035036	Process	Sperm-egg recognition	IDA	39423812
GO:0035036	Process	Sperm-egg recognition	ISS

MIM	HGNC	e!Ensembl
618945	27113	ENSG00000182310

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	W5XKT8
Protein name	Sperm acrosome membrane-associated protein 6 (BACHELOR-like protein)
Protein function	Sperm protein required for fusion of sperm with the egg membrane during fertilization (By similarity). May regulate the expression of sperm surface protein DCST2 (By similarity).
PDB	7TA2
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Detected at the sperm head, equatorial region, neck and midpiece (at protein level) (PubMed:32210282). Expressed in testis (PubMed:24275887). {ECO:0000269\|PubMed:24275887, ECO:0000269\|PubMed:32210282}.
Sequence	MALLALASAVPSALLALAVFRVPAWACLLCFTTYSERLRICQMFVGMRSPKLEECEEAFT AAFQGLSDTEINYDERSHLHDTFTQMTHALQELAAAQGSFEVAFPDAAEKMKKVITQLKE AQACIPPCGLQEFARRFLCSGCYSRVCDLPLDCPVQDVTVTRGDQAMFSCIVNFQLPKEE ITYSWKFAGGGLRTQDLSYFRDMPRAEGYLARIRPAQLTHRGTFSCVIKQDQRPLARLYF FLNVTGPPPRAETELQASFREVLRWAPRDAELIEPWRPSLGELLARPEALTPSNLFLLAV LGALASASATVLAWMFFRWYCSGN
Sequence length	324
Interactions	View interactions