SPACA4 (sperm acrosome associated 4)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 171169 |
| Gene name | Sperm acrosome associated 4 |
| Gene symbol | SPACA4 |
| Synonyms (NCBI Gene) |
SAMP14
|
| Chromosome | 19 |
| Chromosome location | 19q13.33 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
|
|||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8TDM5 | ||||||||||
| Protein name | Sperm acrosome membrane-associated protein 4 (Sperm acrosomal membrane-associated protein 14) | ||||||||||
| Protein function | Sperm surface membrane protein that is essential for effective sperm-zona pellucida binding and penetration during fertilization. | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Tissue specificity | TISSUE SPECIFICITY: Testis specific (PubMed:12788941). Expressed in spermatozoa (PubMed:12788941, PubMed:37377732). {ECO:0000269|PubMed:12788941, ECO:0000269|PubMed:37377732}. | ||||||||||
| Sequence |
MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPV |
||||||||||
| Sequence length | 124 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
|||
|
|||
|
Related Genes
Genes most often co-reported with SPACA4 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SPACA4 (see Related Genes above), that are NOT already directly curated for SPACA4 itself -- a lead worth checking, not a confirmed association.
0
|
|