SP100 (SP100 nuclear antigen)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6672
• Gene name: SP100 nuclear antigen
• Gene symbol: SP100
• Synonyms (NCBI Gene): lysp100b
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded prot

miRNA Show/Hide all (290)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032264	hsa-let-7b-5p	Proteomics	18668040
MIRT205503	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT205506	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT205510	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT236388	hsa-miR-624-3p	PAR-CLIP	23592263
MIRT205504	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT205505	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT453674	hsa-miR-300	PAR-CLIP	23592263
MIRT453673	hsa-miR-381-3p	PAR-CLIP	23592263
MIRT453672	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT453671	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT205508	hsa-miR-3907	PAR-CLIP	23592263
MIRT205511	hsa-miR-6073	PAR-CLIP	23592263
MIRT205507	hsa-miR-3606-5p	PAR-CLIP	23592263
MIRT439557	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439557	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT205503	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT205506	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT205510	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT236388	hsa-miR-624-3p	PAR-CLIP	23592263
MIRT205504	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT205505	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT453674	hsa-miR-300	PAR-CLIP	23592263
MIRT453673	hsa-miR-381-3p	PAR-CLIP	23592263
MIRT453672	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT453671	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT205508	hsa-miR-3907	PAR-CLIP	23592263
MIRT205511	hsa-miR-6073	PAR-CLIP	23592263
MIRT205507	hsa-miR-3606-5p	PAR-CLIP	23592263
MIRT1380797	hsa-miR-1206	CLIP-seq
MIRT1380798	hsa-miR-1263	CLIP-seq
MIRT1380799	hsa-miR-1293	CLIP-seq
MIRT1380800	hsa-miR-129-5p	CLIP-seq
MIRT1380801	hsa-miR-146b-3p	CLIP-seq
MIRT1380802	hsa-miR-205	CLIP-seq
MIRT1380803	hsa-miR-2052	CLIP-seq
MIRT1380804	hsa-miR-2116	CLIP-seq
MIRT1380805	hsa-miR-3122	CLIP-seq
MIRT1380806	hsa-miR-3143	CLIP-seq
MIRT1380807	hsa-miR-3165	CLIP-seq
MIRT1380808	hsa-miR-3179	CLIP-seq
MIRT1380809	hsa-miR-331-5p	CLIP-seq
MIRT1380810	hsa-miR-3622a-3p	CLIP-seq
MIRT1380811	hsa-miR-3622b-3p	CLIP-seq
MIRT1380812	hsa-miR-3689a-3p	CLIP-seq
MIRT1380813	hsa-miR-3689c	CLIP-seq
MIRT1380814	hsa-miR-375	CLIP-seq
MIRT1380815	hsa-miR-384	CLIP-seq
MIRT1380816	hsa-miR-3913-5p	CLIP-seq
MIRT1380817	hsa-miR-3936	CLIP-seq
MIRT1380818	hsa-miR-3978	CLIP-seq
MIRT1380819	hsa-miR-409-5p	CLIP-seq
MIRT1380820	hsa-miR-4273	CLIP-seq
MIRT1380821	hsa-miR-4289	CLIP-seq
MIRT1380822	hsa-miR-4293	CLIP-seq
MIRT1380823	hsa-miR-4297	CLIP-seq
MIRT1380824	hsa-miR-433	CLIP-seq
MIRT1380825	hsa-miR-4452	CLIP-seq
MIRT1380826	hsa-miR-4483	CLIP-seq
MIRT1380827	hsa-miR-4677-5p	CLIP-seq
MIRT1380828	hsa-miR-4678	CLIP-seq
MIRT1380829	hsa-miR-4711-3p	CLIP-seq
MIRT1380830	hsa-miR-4712-5p	CLIP-seq
MIRT1380831	hsa-miR-4724-5p	CLIP-seq
MIRT1380832	hsa-miR-4728-5p	CLIP-seq
MIRT1380833	hsa-miR-4742-3p	CLIP-seq
MIRT1380834	hsa-miR-4778-3p	CLIP-seq
MIRT1380835	hsa-miR-4786-3p	CLIP-seq
MIRT1380836	hsa-miR-511	CLIP-seq
MIRT1380837	hsa-miR-544b	CLIP-seq
MIRT1380838	hsa-miR-590-3p	CLIP-seq
MIRT1380839	hsa-miR-609	CLIP-seq
MIRT1380840	hsa-miR-630	CLIP-seq
MIRT1380841	hsa-miR-651	CLIP-seq
MIRT1380842	hsa-miR-653	CLIP-seq
MIRT1380843	hsa-miR-659	CLIP-seq
MIRT1380844	hsa-miR-770-5p	CLIP-seq
MIRT1380845	hsa-miR-1179	CLIP-seq
MIRT1380846	hsa-miR-1256	CLIP-seq
MIRT1380847	hsa-miR-129-3p	CLIP-seq
MIRT1380848	hsa-miR-2113	CLIP-seq
MIRT1380849	hsa-miR-218	CLIP-seq
MIRT1380850	hsa-miR-219-1-3p	CLIP-seq
MIRT1380851	hsa-miR-2277-3p	CLIP-seq
MIRT1380852	hsa-miR-3065-5p	CLIP-seq
MIRT1380853	hsa-miR-3129-3p	CLIP-seq
MIRT1380854	hsa-miR-3174	CLIP-seq
MIRT1380855	hsa-miR-3177-5p	CLIP-seq
MIRT1380856	hsa-miR-3200-5p	CLIP-seq
MIRT1380809	hsa-miR-331-5p	CLIP-seq
MIRT1380857	hsa-miR-3660	CLIP-seq
MIRT1380858	hsa-miR-411	CLIP-seq
MIRT1380859	hsa-miR-4275	CLIP-seq
MIRT1380860	hsa-miR-4438	CLIP-seq
MIRT1380861	hsa-miR-450b-5p	CLIP-seq
MIRT1380862	hsa-miR-4514	CLIP-seq
MIRT1380863	hsa-miR-452	CLIP-seq
MIRT1380864	hsa-miR-4526	CLIP-seq
MIRT1380865	hsa-miR-4676-3p	CLIP-seq
MIRT1380866	hsa-miR-4692	CLIP-seq
MIRT1380867	hsa-miR-4699-3p	CLIP-seq
MIRT1380868	hsa-miR-4735-5p	CLIP-seq
MIRT1380869	hsa-miR-4772-3p	CLIP-seq
MIRT1380870	hsa-miR-4797-5p	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT1380872	hsa-miR-507	CLIP-seq
MIRT1380873	hsa-miR-5095	CLIP-seq
MIRT1380874	hsa-miR-513a-3p	CLIP-seq
MIRT1380875	hsa-miR-548a-5p	CLIP-seq
MIRT1380876	hsa-miR-548ab	CLIP-seq
MIRT1380877	hsa-miR-548ak	CLIP-seq
MIRT1380878	hsa-miR-548b-3p	CLIP-seq
MIRT1380879	hsa-miR-548b-5p	CLIP-seq
MIRT1380880	hsa-miR-548c-3p	CLIP-seq
MIRT1380881	hsa-miR-548c-5p	CLIP-seq
MIRT1380882	hsa-miR-548d-5p	CLIP-seq
MIRT1380883	hsa-miR-548h	CLIP-seq
MIRT1380884	hsa-miR-548i	CLIP-seq
MIRT1380885	hsa-miR-548j	CLIP-seq
MIRT1380886	hsa-miR-548k	CLIP-seq
MIRT1380887	hsa-miR-548l	CLIP-seq
MIRT1380888	hsa-miR-548w	CLIP-seq
MIRT1380889	hsa-miR-548y	CLIP-seq
MIRT1380890	hsa-miR-557	CLIP-seq
MIRT1380891	hsa-miR-559	CLIP-seq
MIRT1380892	hsa-miR-571	CLIP-seq
MIRT1380893	hsa-miR-642a	CLIP-seq
MIRT1380894	hsa-miR-759	CLIP-seq
MIRT1380895	hsa-miR-891b	CLIP-seq
MIRT1380896	hsa-miR-935	CLIP-seq
MIRT1380897	hsa-miR-938	CLIP-seq
MIRT1380845	hsa-miR-1179	CLIP-seq
MIRT1380846	hsa-miR-1256	CLIP-seq
MIRT1380847	hsa-miR-129-3p	CLIP-seq
MIRT1380800	hsa-miR-129-5p	CLIP-seq
MIRT1380848	hsa-miR-2113	CLIP-seq
MIRT1380849	hsa-miR-218	CLIP-seq
MIRT1380851	hsa-miR-2277-3p	CLIP-seq
MIRT1380852	hsa-miR-3065-5p	CLIP-seq
MIRT1380809	hsa-miR-331-5p	CLIP-seq
MIRT1380858	hsa-miR-411	CLIP-seq
MIRT1380859	hsa-miR-4275	CLIP-seq
MIRT1380861	hsa-miR-450b-5p	CLIP-seq
MIRT1380863	hsa-miR-452	CLIP-seq
MIRT1380865	hsa-miR-4676-3p	CLIP-seq
MIRT1380868	hsa-miR-4735-5p	CLIP-seq
MIRT1380869	hsa-miR-4772-3p	CLIP-seq
MIRT1380870	hsa-miR-4797-5p	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT1380872	hsa-miR-507	CLIP-seq
MIRT1380874	hsa-miR-513a-3p	CLIP-seq
MIRT1380875	hsa-miR-548a-5p	CLIP-seq
MIRT1380876	hsa-miR-548ab	CLIP-seq
MIRT1380877	hsa-miR-548ak	CLIP-seq
MIRT1380878	hsa-miR-548b-3p	CLIP-seq
MIRT1380879	hsa-miR-548b-5p	CLIP-seq
MIRT1380881	hsa-miR-548c-5p	CLIP-seq
MIRT1380882	hsa-miR-548d-5p	CLIP-seq
MIRT1380883	hsa-miR-548h	CLIP-seq
MIRT1380884	hsa-miR-548i	CLIP-seq
MIRT1380885	hsa-miR-548j	CLIP-seq
MIRT1380886	hsa-miR-548k	CLIP-seq
MIRT1380887	hsa-miR-548l	CLIP-seq
MIRT1380888	hsa-miR-548w	CLIP-seq
MIRT1380889	hsa-miR-548y	CLIP-seq
MIRT1380890	hsa-miR-557	CLIP-seq
MIRT1380891	hsa-miR-559	CLIP-seq
MIRT2114015	hsa-miR-587	CLIP-seq
MIRT1380894	hsa-miR-759	CLIP-seq
MIRT1380895	hsa-miR-891b	CLIP-seq
MIRT1380897	hsa-miR-938	CLIP-seq
MIRT1380845	hsa-miR-1179	CLIP-seq
MIRT1380852	hsa-miR-3065-5p	CLIP-seq
MIRT2337023	hsa-miR-4672	CLIP-seq
MIRT1380867	hsa-miR-4699-3p	CLIP-seq
MIRT1380869	hsa-miR-4772-3p	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT1380895	hsa-miR-891b	CLIP-seq
MIRT1380799	hsa-miR-1293	CLIP-seq
MIRT1380807	hsa-miR-3165	CLIP-seq
MIRT1380810	hsa-miR-3622a-3p	CLIP-seq
MIRT1380811	hsa-miR-3622b-3p	CLIP-seq
MIRT1380821	hsa-miR-4289	CLIP-seq
MIRT1380826	hsa-miR-4483	CLIP-seq
MIRT2394990	hsa-miR-4710	CLIP-seq
MIRT2394991	hsa-miR-4792	CLIP-seq
MIRT1380837	hsa-miR-544b	CLIP-seq
MIRT1380842	hsa-miR-653	CLIP-seq
MIRT1380845	hsa-miR-1179	CLIP-seq
MIRT1380852	hsa-miR-3065-5p	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT1380845	hsa-miR-1179	CLIP-seq
MIRT1380852	hsa-miR-3065-5p	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT2630455	hsa-miR-1184	CLIP-seq
MIRT2630456	hsa-miR-1205	CLIP-seq
MIRT2630457	hsa-miR-1243	CLIP-seq
MIRT2630458	hsa-miR-1245b-3p	CLIP-seq
MIRT2630459	hsa-miR-1264	CLIP-seq
MIRT2630460	hsa-miR-1273d	CLIP-seq
MIRT2630461	hsa-miR-1299	CLIP-seq
MIRT2630462	hsa-miR-186	CLIP-seq
MIRT2630463	hsa-miR-18a	CLIP-seq
MIRT2630464	hsa-miR-18b	CLIP-seq
MIRT2630465	hsa-miR-196a	CLIP-seq
MIRT2630466	hsa-miR-196b	CLIP-seq
MIRT2630467	hsa-miR-1972	CLIP-seq
MIRT2630468	hsa-miR-2053	CLIP-seq
MIRT2630469	hsa-miR-2278	CLIP-seq
MIRT2630470	hsa-miR-2964a-5p	CLIP-seq
MIRT2630471	hsa-miR-3074-5p	CLIP-seq
MIRT2630472	hsa-miR-3124-3p	CLIP-seq
MIRT2630473	hsa-miR-3156-5p	CLIP-seq
MIRT2630474	hsa-miR-3158-5p	CLIP-seq
MIRT2630475	hsa-miR-3163	CLIP-seq
MIRT2630476	hsa-miR-34c-3p	CLIP-seq
MIRT2630477	hsa-miR-3545-3p	CLIP-seq
MIRT2630478	hsa-miR-3591-5p	CLIP-seq
MIRT2630479	hsa-miR-3606	CLIP-seq
MIRT2630480	hsa-miR-3662	CLIP-seq
MIRT2630481	hsa-miR-3691-3p	CLIP-seq
MIRT2630482	hsa-miR-381	CLIP-seq
MIRT2630483	hsa-miR-4255	CLIP-seq
MIRT2630484	hsa-miR-4261	CLIP-seq
MIRT2630485	hsa-miR-4263	CLIP-seq
MIRT2630486	hsa-miR-4480	CLIP-seq
MIRT2630487	hsa-miR-4642	CLIP-seq
MIRT2630488	hsa-miR-4652-3p	CLIP-seq
MIRT2630489	hsa-miR-4712-3p	CLIP-seq
MIRT2630490	hsa-miR-4722-3p	CLIP-seq
MIRT2630491	hsa-miR-4729	CLIP-seq
MIRT2630492	hsa-miR-4738-3p	CLIP-seq
MIRT2630493	hsa-miR-4799-5p	CLIP-seq
MIRT2630494	hsa-miR-487a	CLIP-seq
MIRT2630495	hsa-miR-493	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT2630496	hsa-miR-544	CLIP-seq
MIRT1380880	hsa-miR-548c-3p	CLIP-seq
MIRT2630497	hsa-miR-569	CLIP-seq
MIRT2630498	hsa-miR-576-5p	CLIP-seq
MIRT2114015	hsa-miR-587	CLIP-seq
MIRT2630499	hsa-miR-624	CLIP-seq
MIRT2630500	hsa-miR-633	CLIP-seq
MIRT2630501	hsa-miR-646	CLIP-seq
MIRT2630502	hsa-miR-657	CLIP-seq
MIRT2630503	hsa-miR-660	CLIP-seq
MIRT2630504	hsa-miR-875-3p	CLIP-seq
MIRT2630455	hsa-miR-1184	CLIP-seq
MIRT2630456	hsa-miR-1205	CLIP-seq
MIRT2630457	hsa-miR-1243	CLIP-seq
MIRT2630458	hsa-miR-1245b-3p	CLIP-seq
MIRT2630459	hsa-miR-1264	CLIP-seq
MIRT2630460	hsa-miR-1273d	CLIP-seq
MIRT2630461	hsa-miR-1299	CLIP-seq
MIRT2630463	hsa-miR-18a	CLIP-seq
MIRT2630464	hsa-miR-18b	CLIP-seq
MIRT2630465	hsa-miR-196a	CLIP-seq
MIRT2630466	hsa-miR-196b	CLIP-seq
MIRT2630467	hsa-miR-1972	CLIP-seq
MIRT2630470	hsa-miR-2964a-5p	CLIP-seq
MIRT2630471	hsa-miR-3074-5p	CLIP-seq
MIRT2630472	hsa-miR-3124-3p	CLIP-seq
MIRT2630473	hsa-miR-3156-5p	CLIP-seq
MIRT2630474	hsa-miR-3158-5p	CLIP-seq
MIRT2630475	hsa-miR-3163	CLIP-seq
MIRT2630476	hsa-miR-34c-3p	CLIP-seq
MIRT2630477	hsa-miR-3545-3p	CLIP-seq
MIRT2630479	hsa-miR-3606	CLIP-seq
MIRT2630480	hsa-miR-3662	CLIP-seq
MIRT2630481	hsa-miR-3691-3p	CLIP-seq
MIRT2630482	hsa-miR-381	CLIP-seq
MIRT2630484	hsa-miR-4261	CLIP-seq
MIRT2630485	hsa-miR-4263	CLIP-seq
MIRT2630486	hsa-miR-4480	CLIP-seq
MIRT2630487	hsa-miR-4642	CLIP-seq
MIRT2630488	hsa-miR-4652-3p	CLIP-seq
MIRT2630490	hsa-miR-4722-3p	CLIP-seq
MIRT2630491	hsa-miR-4729	CLIP-seq
MIRT2630492	hsa-miR-4738-3p	CLIP-seq
MIRT2630493	hsa-miR-4799-5p	CLIP-seq
MIRT2630494	hsa-miR-487a	CLIP-seq
MIRT2630495	hsa-miR-493	CLIP-seq
MIRT1380871	hsa-miR-505	CLIP-seq
MIRT2630496	hsa-miR-544	CLIP-seq
MIRT1380880	hsa-miR-548c-3p	CLIP-seq
MIRT2630498	hsa-miR-576-5p	CLIP-seq
MIRT2114015	hsa-miR-587	CLIP-seq
MIRT2630499	hsa-miR-624	CLIP-seq
MIRT2630503	hsa-miR-660	CLIP-seq
MIRT2630504	hsa-miR-875-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF9	Activation	8681971

Gene ontology (GO) Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15247905
GO:0000723	Process	Telomere maintenance	IMP	15767676
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	14647468, 15247905, 16873258
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11909962, 16177824
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	15247905
GO:0005515	Function	Protein binding	IPI	9636146, 9636147, 11313457, 12470659, 15247905, 16177824, 16189514, 17000644, 17245429, 21880768, 25416956, 25910212, 27107012, 27211601, 28514442, 31515488, 32296183, 32814053, 33961781, 36217029
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	2258622, 8810287, 9412458, 16873258, 17332504, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	9973607
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	IMP	11313457
GO:0005737	Component	Cytoplasm	IDA	9412458, 17245429
GO:0005737	Component	Cytoplasm	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	IEA
GO:0010596	Process	Negative regulation of endothelial cell migration	IEA
GO:0010596	Process	Negative regulation of endothelial cell migration	IMP	15592518
GO:0016604	Component	Nuclear body	IDA
GO:0016604	Component	Nuclear body	IEA
GO:0016605	Component	PML body	IDA	9230084, 9412458, 9636146, 9973607, 11313457, 12470659, 14647468, 15247905, 16873258, 17245429, 17332504
GO:0016605	Component	PML body	IEA
GO:0019900	Function	Kinase binding	IPI	14647468
GO:0019904	Function	Protein domain specific binding	IPI	9636147
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IDA	14647468
GO:0030870	Component	Mre11 complex	IDA	15767676
GO:0032526	Process	Response to retinoic acid	IDA	11313457
GO:0032897	Process	Negative regulation of viral transcription	IDA	16873258
GO:0034097	Process	Response to cytokine	IDA	9412458, 11313457
GO:0034340	Process	Response to type I interferon	IDA	9230084, 15247905, 16873258
GO:0034340	Process	Response to type I interferon	IMP	8810287
GO:0034341	Process	Response to type II interferon	IDA	9230084
GO:0034341	Process	Response to type II interferon	IMP	8810287
GO:0034399	Component	Nuclear periphery	IDA	11313457
GO:0042802	Function	Identical protein binding	IPI	9636146, 9636147, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IPI	9636146
GO:0045185	Process	Maintenance of protein location	IDA	12470659
GO:0045765	Process	Regulation of angiogenesis	IMP	15592518
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9636147
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	9636146
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11909962, 16177824
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	14647468
GO:0046826	Process	Negative regulation of protein export from nucleus	IMP	17245429
GO:0046983	Function	Protein dimerization activity	IPI	9636146
GO:0048384	Process	Retinoic acid receptor signaling pathway	IC	11313457
GO:0050792	Process	Regulation of viral process	IEA
GO:0060333	Process	Type II interferon-mediated signaling pathway	IC	8810287
GO:0060337	Process	Type I interferon-mediated signaling pathway	IC	8810287
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	11909962
GO:0070087	Function	Chromo shadow domain binding	IPI	9636147, 15882967
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	IMP	17245429
GO:1902044	Process	Regulation of Fas signaling pathway	IMP	17245429

Other IDs

• MIM: 604585
• HGNC: 11206
• e!Ensembl: ENSG00000067066

Protein

• UniProt ID: P23497
• Protein name: Nuclear autoantigen Sp-100 (Nuclear dot-associated Sp100 protein) (Speckled 100 kDa)
• Protein function: Together with PML, this tumor suppressor is a major constituent of the PML bodies, a subnuclear organelle involved in a large number of physiological processes including cell growth, differentiation and apoptosis. Functions as a transcriptional
• PDB: 1H5P , 4PTB , 5FB0 , 5FB1 , 5PWE , 5PWF , 5PWG , 5PWH , 5PWI , 5PWJ , 5PWK , 5PWL , 5PWM , 5PWN , 5PWO , 5PWP , 5PWQ , 5PWR , 5PWS , 5PWT , 5PWU , 5PWV , 5PWW , 5PWX , 5PWY , 5PWZ , 5PX0 , 5PX1 , 5PX2 , 5PX3 , 5PX4 , 5PX5 , 5PX6 , 5PX7 , 5PX8 , 5PX9 , 5PXA , 5PXB , 5PXC , 5PXD , 5PXE , 5PXF , 5PXG , 5PXH , 5PXI , 5PXJ , 5PXK , 5PXL , 5PXM , 5PXN , 5PXO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00505	HMG_box	769 → 837	HMG (high mobility group) box	Domain
  PF01342	SAND	599 → 675	SAND domain	Family
  PF03172	HSR	49 → 147	HSR domain	Domain
  PF09011	HMG_box_2	684 → 752	HMG-box domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines.
• Sequence:

  MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRN
  KVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRNLVPVQRVVYNVLSELEKTFNLP
  VLEALFSDVNMQEYPDLIHIYKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENS
  FRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQ
  KAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK
  PFSNSKVECQAQARTHHNQASDIIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPL
  ESNDEKEGQEATCSRPQIVPEPMDFRKLSTFRESFKKRVIGQDHDFSESSEEEAPAEASS
  GALRSKHGEKAPMTSRSTSTWRIPSRKRRFSSSDFSDLSNGEELQETCSSSLRRGSGSQP
  QEPENKKCSCVMCFPKGVPRSQEARTESSQASDMMDTMDVENNSTLEKHSGKRRKKRRHR
  SKVNGLQRGRKKDRPRKHLTLNNKVQKKRWQQRGRKANTRPLKRRRKRGPRIPKDENINF
  KQSELPVTCGEVKGTLYKERFKQGTSKKCIQSEDKKWFTPREFEIEGDRGASKNWKLSIR
  CGGYTLKVLMENKFLPEPPSTRKKRILESHNNTLVDPCEEHKKKNPDASVKFSEFLKKCS
  ETWKTIFAKEKGKFEDMAKADKAHYEREMKTYIPPKGEKKKKFKDPNAPKRPPLAFFLFC
  SEYRPKIKGEHPGLSIDDVVKKLAGMWNNTAAADKQFYEKKAAKLKEKYKKDIAAYRAKG
  KPNSAKKRVVKAEKSKKKKEEEEDEEDEQEEENEEDDDK

• Sequence length: 879

Pathways

KEGG Pathway	Reactome Pathway
Herpes simplex virus 1 infection	SUMOylation of DNA damage response and repair proteins
Viral carcinogenesis	Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (29)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10921892, 15470359, 18844582, 24089549, 30260704, 9230084		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	17693401	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	8986606, 9089912		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21274506		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33617509	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25884818	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35971449	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35978049	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31779701	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32846838	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38374020	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21274506		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21274506		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37354211	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25884818		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29321523	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10377280, 22503841		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16177824		★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11313457, 9636146	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10052683, 30854688, 36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159788	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21274506		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21274506		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21118961, 29458675		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10377280		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37354211	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10052683, 22503841, 22519587, 26347895, 30854688, 31111679, 31281353, 31714880, 7631159, 8986606, 9089912, 9230084		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	15470359		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	24453968	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HDAC7 2 shared pathwaysViral carcinogenesis, SUMOylation of DNA damage response and repair proteins Related via 2 shared pathways including Viral carcinogenesis, SUMOylation of DNA damage response and repair proteins. PML 3 shared pathwaysHerpes simplex virus 1 infection, SUMOylation of DNA damage response and repair proteins, Interferon gamma signaling Related via 3 shared pathways including Herpes simplex virus 1 infection, SUMOylation of DNA damage response and repair proteins. IRF9 3 shared pathwaysHerpes simplex virus 1 infection, Viral carcinogenesis, Interferon gamma signaling Related via 3 shared pathways including Herpes simplex virus 1 infection, Viral carcinogenesis. OAS1 2 shared pathwaysHerpes simplex virus 1 infection, Interferon gamma signaling Related via 2 shared pathways including Herpes simplex virus 1 infection, Interferon gamma signaling. OAS2 2 shared pathwaysHerpes simplex virus 1 infection, Interferon gamma signaling Related via 2 shared pathways including Herpes simplex virus 1 infection, Interferon gamma signaling.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HDAC7	0	[]	2	["Viral carcinogenesis","SUMOylation of DNA damage response and repair proteins"]	0	[]
PML	0	[]	3	["Herpes simplex virus 1 infection","SUMOylation of DNA damage response and repair proteins","Interferon gamma signaling"]	0	[]
IRF9	0	[]	3	["Herpes simplex virus 1 infection","Viral carcinogenesis","Interferon gamma signaling"]	0	[]
OAS1	0	[]	2	["Herpes simplex virus 1 infection","Interferon gamma signaling"]	0	[]
OAS2	0	[]	2	["Herpes simplex virus 1 infection","Interferon gamma signaling"]	0	[]

Diseases Linked via Similar Genes

Asthma Linked via 2 of 5 related genesHDAC7, OAS2 Hypertension Linked via 2 of 5 related genesHDAC7, OAS1 Diabetes mellitus type 2 Linked via 2 of 5 related genesPML, OAS1 Immunodeficiency Linked via 2 of 5 related genesIRF9, OAS1 Ankylosing spondylitis Linked via 1 of 5 related genesHDAC7

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Asthma	2	["HDAC7","OAS2"]
Hypertension	2	["HDAC7","OAS1"]
Diabetes mellitus type 2	2	["PML","OAS1"]
Immunodeficiency	2	["IRF9","OAS1"]
Ankylosing spondylitis	1	["HDAC7"]