SOX21 (SRY-box transcription factor 21)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 11166
• Gene name: SRY-box transcription factor 21
• Gene symbol: SOX21
• Synonyms (NCBI Gene): SOX25
• Chromosome: 13
• Chromosome location: 13q32.1
• Summary: SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are d

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1380412	hsa-miR-342-3p	CLIP-seq
MIRT1380413	hsa-miR-377	CLIP-seq
MIRT1380414	hsa-miR-425	CLIP-seq
MIRT1380415	hsa-miR-4328	CLIP-seq
MIRT1380416	hsa-miR-4639-5p	CLIP-seq
MIRT1380417	hsa-miR-4659a-3p	CLIP-seq
MIRT1380418	hsa-miR-4659b-3p	CLIP-seq
MIRT1380419	hsa-miR-4731-3p	CLIP-seq
MIRT1380420	hsa-miR-4753-5p	CLIP-seq
MIRT1380421	hsa-miR-4801	CLIP-seq
MIRT1380422	hsa-miR-548aa	CLIP-seq
MIRT1380423	hsa-miR-548m	CLIP-seq
MIRT1380424	hsa-miR-642b	CLIP-seq
MIRT1380425	hsa-miR-646	CLIP-seq
MIRT2336857	hsa-miR-1275	CLIP-seq
MIRT2336858	hsa-miR-3605-3p	CLIP-seq
MIRT2336859	hsa-miR-4656	CLIP-seq
MIRT2336860	hsa-miR-4665-5p	CLIP-seq
MIRT2336861	hsa-miR-4691-5p	CLIP-seq
MIRT2460283	hsa-miR-4476	CLIP-seq
MIRT2460284	hsa-miR-4668-3p	CLIP-seq
MIRT2460285	hsa-miR-549	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	NAS	10441749
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	10441749
GO:0007420	Process	Brain development	IBA
GO:0030182	Process	Neuron differentiation	IBA
GO:0032502	Process	Developmental process	IEA
GO:0042633	Process	Hair cycle	IEA
GO:0043588	Process	Skin development	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048863	Process	Stem cell differentiation	IDA	20876214

Other IDs

• MIM: 604974
• HGNC: 11197
• e!Ensembl: ENSG00000125285

Protein

• UniProt ID: Q9Y651
• Protein name: Transcription factor SOX-21 (SOX-A)
• Protein function: May play a role as an activator of transcription of OPRM1. Overexpression of SOX21 can up-regulate the OPRM1 distal promoter activity in mor-expressing neuronal cells. May play a role in ameloblast differentiation. {ECO:0000250|UniProtKB:Q811W0}
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00505	HMG_box	8 → 76	HMG (high mobility group) box	Domain
  PF12336	SOXp	77 → 167	SOX transcription factor	Family

• Sequence:

  MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDE
  AKRLRAMHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG
  AGGGLVPESLLANPEKAAAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMA
  EISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAGGHTHSHPSPGNPGYMIPCNC
  SAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL

• Sequence length: 276

Related Genes

No strongly related genes found yet for SOX21.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SOX21.