Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	9021
Gene name	Suppressor of cytokine signaling 3
Gene symbol	SOCS3
Synonyms (NCBI Gene)	ATOD4CIS3Cish3SOCS-3SSI-3SSI3
Chromosome	17
Chromosome location	17q25.3
Summary	This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced

455

Show/Hide all (455)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005062	hsa-miR-203a-3p	ImmunohistochemistryIn situ hybridizationMicroarrayWestern blot	17622355
MIRT005062	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	22207897
MIRT005062	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	22207897
MIRT007129	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT054389	hsa-let-7f-5p	Luciferase reporter assay	22894925
MIRT005062	hsa-miR-203a-3p	ELISAqRT-PCR	23775225
MIRT438883	hsa-miR-155-5p	qRT-PCR	23428672
MIRT438546	hsa-miR-221-3p	Luciferase reporter assayWestern blot	25019494
MIRT438546	hsa-miR-221-3p	Luciferase reporter assayWestern blot	25019494
MIRT438094	hsa-miR-19a-3p	Luciferase reporter assay	23894411
MIRT438094	hsa-miR-19a-3p	Luciferase reporter assay	23894411
MIRT438883	hsa-miR-155-5p	qRT-PCR	23428672
MIRT438546	hsa-miR-221-3p	Luciferase reporter assayWestern blot	25019494
MIRT438546	hsa-miR-221-3p	Luciferase reporter assayWestern blot	25019494
MIRT438094	hsa-miR-19a-3p	Luciferase reporter assay	23894411
MIRT438094	hsa-miR-19a-3p	Luciferase reporter assay	23894411
MIRT534120	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT534119	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT534118	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT534117	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT534116	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT534115	hsa-miR-4473	PAR-CLIP	22012620
MIRT534114	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT534113	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT467411	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT467410	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT007129	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT467409	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT467408	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT467407	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT467406	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT467405	hsa-miR-8062	PAR-CLIP	23592263
MIRT467404	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT467403	hsa-miR-759	PAR-CLIP	23592263
MIRT467401	hsa-miR-4765	PAR-CLIP	23592263
MIRT467402	hsa-miR-508-3p	PAR-CLIP	23592263
MIRT467400	hsa-miR-4477a	PAR-CLIP	23592263
MIRT467399	hsa-miR-6765-5p	PAR-CLIP	23592263
MIRT467398	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT438094	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726475	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT007129	hsa-miR-30c-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	26707189
MIRT732459	hsa-miR-4449	Luciferase reporter assayqRT-PCRWestern blotting	33854373
MIRT467408	hsa-miR-30e-5p	Luciferase reporter assayImmunoprecipitaion (IP)ELISA	32688283
MIRT735666	hsa-miR-324-5p	Luciferase reporter assayWestern blottingqRT-PCRELISA	33191336
MIRT726475	hsa-miR-19b-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31667786
MIRT534120	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT534119	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT534118	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT534117	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT534116	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT534115	hsa-miR-4473	PAR-CLIP	22012620
MIRT534114	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT534113	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT467411	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT467410	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT007129	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT467409	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT467408	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT467407	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT467406	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT467405	hsa-miR-8062	PAR-CLIP	23592263
MIRT467404	hsa-miR-126-5p	PAR-CLIP	23592263
MIRT467403	hsa-miR-759	PAR-CLIP	23592263
MIRT467401	hsa-miR-4765	PAR-CLIP	23592263
MIRT467402	hsa-miR-508-3p	PAR-CLIP	23592263
MIRT467400	hsa-miR-4477a	PAR-CLIP	23592263
MIRT467399	hsa-miR-6765-5p	PAR-CLIP	23592263
MIRT467398	hsa-miR-1304-5p	PAR-CLIP	23592263
MIRT755584	hsa-miR-181a	Luciferase reporter assayWestern blottingqRT-PCR	34873301
MIRT755584	hsa-miR-181a	Luciferase reporter assayWestern blottingqRT-PCR	34873301
MIRT726475	hsa-miR-19b-3p	Luciferase reporter assayWestern blottingqRT-PCR	36484970
MIRT1378519	hsa-miR-1266	CLIP-seq
MIRT1378520	hsa-miR-1290	CLIP-seq
MIRT1378521	hsa-miR-1291	CLIP-seq
MIRT1378522	hsa-miR-148a	CLIP-seq
MIRT1378523	hsa-miR-148b	CLIP-seq
MIRT1378524	hsa-miR-152	CLIP-seq
MIRT1378525	hsa-miR-1827	CLIP-seq
MIRT1378526	hsa-miR-183	CLIP-seq
MIRT1378527	hsa-miR-1908	CLIP-seq
MIRT1378528	hsa-miR-19a	CLIP-seq
MIRT1378529	hsa-miR-19b	CLIP-seq
MIRT1378530	hsa-miR-203	CLIP-seq
MIRT1378531	hsa-miR-216b	CLIP-seq
MIRT1378532	hsa-miR-2467-3p	CLIP-seq
MIRT1378533	hsa-miR-2861	CLIP-seq
MIRT1378534	hsa-miR-3202	CLIP-seq
MIRT1378535	hsa-miR-3529	CLIP-seq
MIRT1378536	hsa-miR-3612	CLIP-seq
MIRT1378537	hsa-miR-3663-3p	CLIP-seq
MIRT1378538	hsa-miR-3664-3p	CLIP-seq
MIRT1378539	hsa-miR-378g	CLIP-seq
MIRT1378540	hsa-miR-379	CLIP-seq
MIRT1378541	hsa-miR-383	CLIP-seq
MIRT1378542	hsa-miR-3927	CLIP-seq
MIRT1378543	hsa-miR-4269	CLIP-seq
MIRT1378544	hsa-miR-4270	CLIP-seq
MIRT1378545	hsa-miR-4271	CLIP-seq
MIRT1378546	hsa-miR-4278	CLIP-seq
MIRT1378547	hsa-miR-4292	CLIP-seq
MIRT1378548	hsa-miR-4313	CLIP-seq
MIRT1378549	hsa-miR-4420	CLIP-seq
MIRT1378550	hsa-miR-4427	CLIP-seq
MIRT1378551	hsa-miR-4437	CLIP-seq
MIRT1378552	hsa-miR-4441	CLIP-seq
MIRT1378553	hsa-miR-4443	CLIP-seq
MIRT1378554	hsa-miR-4455	CLIP-seq
MIRT1378555	hsa-miR-4476	CLIP-seq
MIRT1378556	hsa-miR-4477b	CLIP-seq
MIRT1378557	hsa-miR-450b-3p	CLIP-seq
MIRT1378558	hsa-miR-4512	CLIP-seq
MIRT1378559	hsa-miR-4514	CLIP-seq
MIRT1378560	hsa-miR-4518	CLIP-seq
MIRT1378561	hsa-miR-4674	CLIP-seq
MIRT1378562	hsa-miR-4680-3p	CLIP-seq
MIRT1378563	hsa-miR-4692	CLIP-seq
MIRT1378564	hsa-miR-4716-3p	CLIP-seq
MIRT1378565	hsa-miR-4723-5p	CLIP-seq
MIRT1378566	hsa-miR-4725-3p	CLIP-seq
MIRT1378567	hsa-miR-4733-3p	CLIP-seq
MIRT1378568	hsa-miR-4742-5p	CLIP-seq
MIRT1378569	hsa-miR-4762-3p	CLIP-seq
MIRT1378570	hsa-miR-4772-5p	CLIP-seq
MIRT1378571	hsa-miR-498	CLIP-seq
MIRT1378572	hsa-miR-518a-5p	CLIP-seq
MIRT1378573	hsa-miR-524-3p	CLIP-seq
MIRT1378574	hsa-miR-525-3p	CLIP-seq
MIRT1378575	hsa-miR-527	CLIP-seq
MIRT1378576	hsa-miR-561	CLIP-seq
MIRT1378577	hsa-miR-591	CLIP-seq
MIRT1378578	hsa-miR-649	CLIP-seq
MIRT1378579	hsa-miR-650	CLIP-seq
MIRT1378580	hsa-miR-653	CLIP-seq
MIRT1378581	hsa-miR-663	CLIP-seq
MIRT1378582	hsa-miR-668	CLIP-seq
MIRT1378583	hsa-miR-769-3p	CLIP-seq
MIRT1378584	hsa-miR-890	CLIP-seq
MIRT2112968	hsa-miR-1203	CLIP-seq
MIRT1378522	hsa-miR-148a	CLIP-seq
MIRT1378523	hsa-miR-148b	CLIP-seq
MIRT1378524	hsa-miR-152	CLIP-seq
MIRT1378526	hsa-miR-183	CLIP-seq
MIRT2112969	hsa-miR-34a	CLIP-seq
MIRT2112970	hsa-miR-34c-5p	CLIP-seq
MIRT1378541	hsa-miR-383	CLIP-seq
MIRT2112971	hsa-miR-3938	CLIP-seq
MIRT1378544	hsa-miR-4270	CLIP-seq
MIRT1378547	hsa-miR-4292	CLIP-seq
MIRT2112972	hsa-miR-4308	CLIP-seq
MIRT1378549	hsa-miR-4420	CLIP-seq
MIRT1378552	hsa-miR-4441	CLIP-seq
MIRT2112973	hsa-miR-449a	CLIP-seq
MIRT2112974	hsa-miR-449b	CLIP-seq
MIRT1378559	hsa-miR-4514	CLIP-seq
MIRT2112975	hsa-miR-4691-5p	CLIP-seq
MIRT1378563	hsa-miR-4692	CLIP-seq
MIRT2112976	hsa-miR-4699-5p	CLIP-seq
MIRT2112977	hsa-miR-4709-3p	CLIP-seq
MIRT1378570	hsa-miR-4772-5p	CLIP-seq
MIRT1378576	hsa-miR-561	CLIP-seq
MIRT1378582	hsa-miR-668	CLIP-seq
MIRT2112978	hsa-miR-670	CLIP-seq
MIRT2335851	hsa-miR-1184	CLIP-seq
MIRT2335852	hsa-miR-1205	CLIP-seq
MIRT2335853	hsa-miR-1909	CLIP-seq
MIRT1378532	hsa-miR-2467-3p	CLIP-seq
MIRT2335854	hsa-miR-3158-5p	CLIP-seq
MIRT2335855	hsa-miR-3616-3p	CLIP-seq
MIRT1378537	hsa-miR-3663-3p	CLIP-seq
MIRT1378538	hsa-miR-3664-3p	CLIP-seq
MIRT1378544	hsa-miR-4270	CLIP-seq
MIRT2335856	hsa-miR-4274	CLIP-seq
MIRT1378548	hsa-miR-4313	CLIP-seq
MIRT2335857	hsa-miR-4436b-3p	CLIP-seq
MIRT1378552	hsa-miR-4441	CLIP-seq
MIRT1378558	hsa-miR-4512	CLIP-seq
MIRT2335858	hsa-miR-4532	CLIP-seq
MIRT2335859	hsa-miR-455-3p	CLIP-seq
MIRT2335860	hsa-miR-4651	CLIP-seq
MIRT1378571	hsa-miR-498	CLIP-seq
MIRT2335861	hsa-miR-544	CLIP-seq
MIRT2335862	hsa-miR-599	CLIP-seq
MIRT2335863	hsa-miR-608	CLIP-seq
MIRT2335864	hsa-miR-642b	CLIP-seq
MIRT2335865	hsa-miR-885-3p	CLIP-seq
MIRT1378533	hsa-miR-2861	CLIP-seq
MIRT1378536	hsa-miR-3612	CLIP-seq
MIRT1378546	hsa-miR-4278	CLIP-seq
MIRT1378548	hsa-miR-4313	CLIP-seq
MIRT1378558	hsa-miR-4512	CLIP-seq
MIRT1378564	hsa-miR-4716-3p	CLIP-seq
MIRT1378565	hsa-miR-4723-5p	CLIP-seq
MIRT2394948	hsa-miR-4726-3p	CLIP-seq
MIRT2394949	hsa-miR-4728-5p	CLIP-seq
MIRT2335862	hsa-miR-599	CLIP-seq
MIRT2335864	hsa-miR-642b	CLIP-seq
MIRT1378579	hsa-miR-650	CLIP-seq
MIRT1378520	hsa-miR-1290	CLIP-seq
MIRT1378528	hsa-miR-19a	CLIP-seq
MIRT1378529	hsa-miR-19b	CLIP-seq
MIRT1378530	hsa-miR-203	CLIP-seq
MIRT1378533	hsa-miR-2861	CLIP-seq
MIRT2433351	hsa-miR-331-3p	CLIP-seq
MIRT1378536	hsa-miR-3612	CLIP-seq
MIRT1378550	hsa-miR-4427	CLIP-seq
MIRT1378557	hsa-miR-450b-3p	CLIP-seq
MIRT1378558	hsa-miR-4512	CLIP-seq
MIRT1378562	hsa-miR-4680-3p	CLIP-seq
MIRT1378569	hsa-miR-4762-3p	CLIP-seq
MIRT1378571	hsa-miR-498	CLIP-seq
MIRT1378572	hsa-miR-518a-5p	CLIP-seq
MIRT1378575	hsa-miR-527	CLIP-seq
MIRT1378576	hsa-miR-561	CLIP-seq
MIRT1378579	hsa-miR-650	CLIP-seq
MIRT1378580	hsa-miR-653	CLIP-seq
MIRT1378583	hsa-miR-769-3p	CLIP-seq
MIRT1378584	hsa-miR-890	CLIP-seq
MIRT2335851	hsa-miR-1184	CLIP-seq
MIRT2440625	hsa-miR-1193	CLIP-seq
MIRT2335852	hsa-miR-1205	CLIP-seq
MIRT2440626	hsa-miR-1207-3p	CLIP-seq
MIRT2440627	hsa-miR-1226	CLIP-seq
MIRT2440628	hsa-miR-1236	CLIP-seq
MIRT2440629	hsa-miR-1265	CLIP-seq
MIRT2440630	hsa-miR-1321	CLIP-seq
MIRT1378522	hsa-miR-148a	CLIP-seq
MIRT1378523	hsa-miR-148b	CLIP-seq
MIRT1378524	hsa-miR-152	CLIP-seq
MIRT2440631	hsa-miR-1587	CLIP-seq
MIRT2440632	hsa-miR-1825	CLIP-seq
MIRT1378525	hsa-miR-1827	CLIP-seq
MIRT1378526	hsa-miR-183	CLIP-seq
MIRT1378527	hsa-miR-1908	CLIP-seq
MIRT2335853	hsa-miR-1909	CLIP-seq
MIRT2440633	hsa-miR-1915	CLIP-seq
MIRT2440634	hsa-miR-1976	CLIP-seq
MIRT2440635	hsa-miR-2392	CLIP-seq
MIRT1378532	hsa-miR-2467-3p	CLIP-seq
MIRT1378533	hsa-miR-2861	CLIP-seq
MIRT2440636	hsa-miR-299-3p	CLIP-seq
MIRT2440637	hsa-miR-3064-3p	CLIP-seq
MIRT2440638	hsa-miR-3064-5p	CLIP-seq
MIRT2440639	hsa-miR-30a	CLIP-seq
MIRT2440640	hsa-miR-30b	CLIP-seq
MIRT2440641	hsa-miR-30c	CLIP-seq
MIRT2440642	hsa-miR-30d	CLIP-seq
MIRT2440643	hsa-miR-30e	CLIP-seq
MIRT2440644	hsa-miR-3124-3p	CLIP-seq
MIRT2440645	hsa-miR-3150b-3p	CLIP-seq
MIRT2440646	hsa-miR-3151	CLIP-seq
MIRT2440647	hsa-miR-3155	CLIP-seq
MIRT2440648	hsa-miR-3155b	CLIP-seq
MIRT2335854	hsa-miR-3158-5p	CLIP-seq
MIRT2440649	hsa-miR-3183	CLIP-seq
MIRT2440650	hsa-miR-3184	CLIP-seq
MIRT2440651	hsa-miR-3192	CLIP-seq
MIRT2440652	hsa-miR-3194-5p	CLIP-seq
MIRT2440653	hsa-miR-342-5p	CLIP-seq
MIRT2112969	hsa-miR-34a	CLIP-seq
MIRT2112970	hsa-miR-34c-5p	CLIP-seq
MIRT2440654	hsa-miR-3605-5p	CLIP-seq
MIRT1378536	hsa-miR-3612	CLIP-seq
MIRT2440655	hsa-miR-361-3p	CLIP-seq
MIRT2335855	hsa-miR-3616-3p	CLIP-seq
MIRT2440656	hsa-miR-3622b-5p	CLIP-seq
MIRT2440657	hsa-miR-3649	CLIP-seq
MIRT2440658	hsa-miR-3661	CLIP-seq
MIRT1378537	hsa-miR-3663-3p	CLIP-seq
MIRT1378538	hsa-miR-3664-3p	CLIP-seq
MIRT2440659	hsa-miR-3679-3p	CLIP-seq
MIRT2440660	hsa-miR-3689a-3p	CLIP-seq
MIRT2440661	hsa-miR-3689c	CLIP-seq
MIRT1378541	hsa-miR-383	CLIP-seq
MIRT2440662	hsa-miR-3944-5p	CLIP-seq
MIRT2440663	hsa-miR-423-5p	CLIP-seq
MIRT2440664	hsa-miR-4265	CLIP-seq
MIRT2440665	hsa-miR-4267	CLIP-seq
MIRT1378544	hsa-miR-4270	CLIP-seq
MIRT2335856	hsa-miR-4274	CLIP-seq
MIRT2440666	hsa-miR-4286	CLIP-seq
MIRT1378547	hsa-miR-4292	CLIP-seq
MIRT2440667	hsa-miR-4296	CLIP-seq
MIRT2112972	hsa-miR-4308	CLIP-seq
MIRT2440668	hsa-miR-4322	CLIP-seq
MIRT2440669	hsa-miR-4417	CLIP-seq
MIRT2440670	hsa-miR-4419a	CLIP-seq
MIRT1378549	hsa-miR-4420	CLIP-seq
MIRT2440671	hsa-miR-4436a	CLIP-seq
MIRT2335857	hsa-miR-4436b-3p	CLIP-seq
MIRT1378552	hsa-miR-4441	CLIP-seq
MIRT2440672	hsa-miR-4446-3p	CLIP-seq
MIRT2440673	hsa-miR-4447	CLIP-seq
MIRT1378554	hsa-miR-4455	CLIP-seq
MIRT2440674	hsa-miR-4456	CLIP-seq
MIRT2440675	hsa-miR-4459	CLIP-seq
MIRT2440676	hsa-miR-4472	CLIP-seq
MIRT2440677	hsa-miR-4492	CLIP-seq
MIRT2440678	hsa-miR-4498	CLIP-seq
MIRT2112973	hsa-miR-449a	CLIP-seq
MIRT2112974	hsa-miR-449b	CLIP-seq
MIRT2440679	hsa-miR-4508	CLIP-seq
MIRT2440680	hsa-miR-4510	CLIP-seq
MIRT1378559	hsa-miR-4514	CLIP-seq
MIRT2335858	hsa-miR-4532	CLIP-seq
MIRT2335859	hsa-miR-455-3p	CLIP-seq
MIRT2440681	hsa-miR-4645-5p	CLIP-seq
MIRT2440682	hsa-miR-4648	CLIP-seq
MIRT2335860	hsa-miR-4651	CLIP-seq
MIRT2440683	hsa-miR-4656	CLIP-seq
MIRT2440684	hsa-miR-4661-3p	CLIP-seq
MIRT2440685	hsa-miR-4664-5p	CLIP-seq
MIRT2440686	hsa-miR-4673	CLIP-seq
MIRT2440687	hsa-miR-4675	CLIP-seq
MIRT2440688	hsa-miR-4687-3p	CLIP-seq
MIRT1378563	hsa-miR-4692	CLIP-seq
MIRT2440689	hsa-miR-4700-3p	CLIP-seq
MIRT2440690	hsa-miR-4721	CLIP-seq
MIRT2440691	hsa-miR-4722-5p	CLIP-seq
MIRT2440692	hsa-miR-4723-3p	CLIP-seq
MIRT2394948	hsa-miR-4726-3p	CLIP-seq
MIRT2394949	hsa-miR-4728-5p	CLIP-seq
MIRT1378567	hsa-miR-4733-3p	CLIP-seq
MIRT2440693	hsa-miR-4739	CLIP-seq
MIRT2440694	hsa-miR-4741	CLIP-seq
MIRT2440695	hsa-miR-4756-5p	CLIP-seq
MIRT2440696	hsa-miR-4764-5p	CLIP-seq
MIRT1378570	hsa-miR-4772-5p	CLIP-seq
MIRT2440697	hsa-miR-4779	CLIP-seq
MIRT2440698	hsa-miR-4784	CLIP-seq
MIRT2440699	hsa-miR-484	CLIP-seq
MIRT2440700	hsa-miR-486-3p	CLIP-seq
MIRT2440701	hsa-miR-491-5p	CLIP-seq
MIRT2440702	hsa-miR-492	CLIP-seq
MIRT2440703	hsa-miR-515-5p	CLIP-seq
MIRT2440704	hsa-miR-541	CLIP-seq
MIRT2335861	hsa-miR-544	CLIP-seq
MIRT2440705	hsa-miR-548v	CLIP-seq
MIRT1378577	hsa-miR-591	CLIP-seq
MIRT2335862	hsa-miR-599	CLIP-seq
MIRT2335863	hsa-miR-608	CLIP-seq
MIRT2440706	hsa-miR-629	CLIP-seq
MIRT2440707	hsa-miR-631	CLIP-seq
MIRT2335864	hsa-miR-642b	CLIP-seq
MIRT1378579	hsa-miR-650	CLIP-seq
MIRT2440708	hsa-miR-654-5p	CLIP-seq
MIRT2440709	hsa-miR-661	CLIP-seq
MIRT1378581	hsa-miR-663	CLIP-seq
MIRT1378582	hsa-miR-668	CLIP-seq
MIRT2112978	hsa-miR-670	CLIP-seq
MIRT2440710	hsa-miR-718	CLIP-seq
MIRT2440711	hsa-miR-762	CLIP-seq
MIRT2440712	hsa-miR-765	CLIP-seq
MIRT2440713	hsa-miR-766	CLIP-seq
MIRT2335865	hsa-miR-885-3p	CLIP-seq
MIRT2440714	hsa-miR-940	CLIP-seq
MIRT2440626	hsa-miR-1207-3p	CLIP-seq
MIRT2440632	hsa-miR-1825	CLIP-seq
MIRT1378525	hsa-miR-1827	CLIP-seq
MIRT2440636	hsa-miR-299-3p	CLIP-seq
MIRT2440639	hsa-miR-30a	CLIP-seq
MIRT2440640	hsa-miR-30b	CLIP-seq
MIRT2440641	hsa-miR-30c	CLIP-seq
MIRT2440642	hsa-miR-30d	CLIP-seq
MIRT2440643	hsa-miR-30e	CLIP-seq
MIRT2630125	hsa-miR-3119	CLIP-seq
MIRT2440644	hsa-miR-3124-3p	CLIP-seq
MIRT2440651	hsa-miR-3192	CLIP-seq
MIRT2630126	hsa-miR-337-3p	CLIP-seq
MIRT2630127	hsa-miR-3685	CLIP-seq
MIRT2440660	hsa-miR-3689a-3p	CLIP-seq
MIRT2440661	hsa-miR-3689c	CLIP-seq
MIRT2630128	hsa-miR-384	CLIP-seq
MIRT2630129	hsa-miR-3929	CLIP-seq
MIRT2440666	hsa-miR-4286	CLIP-seq
MIRT1378547	hsa-miR-4292	CLIP-seq
MIRT2112972	hsa-miR-4308	CLIP-seq
MIRT2630130	hsa-miR-4419b	CLIP-seq
MIRT2630131	hsa-miR-4474-3p	CLIP-seq
MIRT2630132	hsa-miR-4478	CLIP-seq
MIRT2630133	hsa-miR-4491	CLIP-seq
MIRT2630134	hsa-miR-4657	CLIP-seq
MIRT2630135	hsa-miR-4728-3p	CLIP-seq
MIRT2394949	hsa-miR-4728-5p	CLIP-seq
MIRT2630136	hsa-miR-495	CLIP-seq
MIRT2630137	hsa-miR-496	CLIP-seq
MIRT2112978	hsa-miR-670	CLIP-seq
MIRT2440710	hsa-miR-718	CLIP-seq
MIRT2440626	hsa-miR-1207-3p	CLIP-seq
MIRT2440631	hsa-miR-1587	CLIP-seq
MIRT2440632	hsa-miR-1825	CLIP-seq
MIRT1378525	hsa-miR-1827	CLIP-seq
MIRT2691727	hsa-miR-199a-5p	CLIP-seq
MIRT2691728	hsa-miR-199b-5p	CLIP-seq
MIRT2691729	hsa-miR-2114	CLIP-seq
MIRT2440636	hsa-miR-299-3p	CLIP-seq
MIRT2440638	hsa-miR-3064-5p	CLIP-seq
MIRT2440639	hsa-miR-30a	CLIP-seq
MIRT2440640	hsa-miR-30b	CLIP-seq
MIRT2440641	hsa-miR-30c	CLIP-seq
MIRT2440642	hsa-miR-30d	CLIP-seq
MIRT2440643	hsa-miR-30e	CLIP-seq
MIRT2630125	hsa-miR-3119	CLIP-seq
MIRT2440644	hsa-miR-3124-3p	CLIP-seq
MIRT2691730	hsa-miR-3174	CLIP-seq
MIRT2440651	hsa-miR-3192	CLIP-seq
MIRT2630126	hsa-miR-337-3p	CLIP-seq
MIRT1378536	hsa-miR-3612	CLIP-seq
MIRT2691731	hsa-miR-3613-3p	CLIP-seq
MIRT2440656	hsa-miR-3622b-5p	CLIP-seq
MIRT2630127	hsa-miR-3685	CLIP-seq
MIRT2440660	hsa-miR-3689a-3p	CLIP-seq
MIRT2440661	hsa-miR-3689c	CLIP-seq
MIRT2630128	hsa-miR-384	CLIP-seq
MIRT2691732	hsa-miR-3925-3p	CLIP-seq
MIRT2630129	hsa-miR-3929	CLIP-seq
MIRT2440664	hsa-miR-4265	CLIP-seq
MIRT2440666	hsa-miR-4286	CLIP-seq
MIRT2691733	hsa-miR-4290	CLIP-seq
MIRT1378547	hsa-miR-4292	CLIP-seq
MIRT2440667	hsa-miR-4296	CLIP-seq
MIRT2112972	hsa-miR-4308	CLIP-seq
MIRT1378548	hsa-miR-4313	CLIP-seq
MIRT2440668	hsa-miR-4322	CLIP-seq
MIRT2440669	hsa-miR-4417	CLIP-seq
MIRT2630130	hsa-miR-4419b	CLIP-seq
MIRT2630131	hsa-miR-4474-3p	CLIP-seq
MIRT2630132	hsa-miR-4478	CLIP-seq
MIRT2630133	hsa-miR-4491	CLIP-seq
MIRT2440677	hsa-miR-4492	CLIP-seq
MIRT2440678	hsa-miR-4498	CLIP-seq
MIRT2440683	hsa-miR-4656	CLIP-seq
MIRT2630134	hsa-miR-4657	CLIP-seq
MIRT2440687	hsa-miR-4675	CLIP-seq
MIRT2440688	hsa-miR-4687-3p	CLIP-seq
MIRT2630135	hsa-miR-4728-3p	CLIP-seq
MIRT2394949	hsa-miR-4728-5p	CLIP-seq
MIRT2440694	hsa-miR-4741	CLIP-seq
MIRT2630137	hsa-miR-496	CLIP-seq
MIRT2691734	hsa-miR-548a-3p	CLIP-seq
MIRT2691735	hsa-miR-548ae	CLIP-seq
MIRT2691736	hsa-miR-548aj	CLIP-seq
MIRT2691737	hsa-miR-548am	CLIP-seq
MIRT2691738	hsa-miR-548e	CLIP-seq
MIRT2691739	hsa-miR-548f	CLIP-seq
MIRT2691740	hsa-miR-548g	CLIP-seq
MIRT2440705	hsa-miR-548v	CLIP-seq
MIRT2691741	hsa-miR-548x	CLIP-seq
MIRT2335862	hsa-miR-599	CLIP-seq
MIRT2440706	hsa-miR-629	CLIP-seq
MIRT2335864	hsa-miR-642b	CLIP-seq
MIRT1378579	hsa-miR-650	CLIP-seq
MIRT2112978	hsa-miR-670	CLIP-seq
MIRT2440710	hsa-miR-718	CLIP-seq
MIRT2440711	hsa-miR-762	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
CEBPA	Activation	19332118
NFKB1	Unknown	23335796
RELA	Unknown	23335796
SP3	Unknown	10570957
STAT1	Unknown	19115200
STAT3	Activation	11788008;15184887;19332118;20357037;22179221
STAT3	Unknown	23335796
STAT4	Repression	14559241

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	9266833
GO:0005126	Function	Cytokine receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	19027008, 24728074, 25203322, 25416956, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	9727029
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IDA	9727029
GO:0035198	Function	MiRNA binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	9266833
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	25019494
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
604176	19391	ENSG00000184557

O14543

Protein name

Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (STAT-induced STAT inhibitor 3) (SSI-3)

Protein function

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	46 → 127	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.

Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Sequence length

225

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (381)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15069015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29194340, 31799684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17376806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19524687, 31619584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	28144985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26482433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	12547716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22820139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	29172719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29471302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28418931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	28418931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25286386, 26482433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	27236299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23108375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19638576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	25034082, 29528877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26812031		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21481788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19083014, 23430591, 23545584, 28217098, 31621532, 31694925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11748261, 16710471, 20690084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	20690084	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	17530721, 37445800, 38001449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21811995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15535835, 20690084, 30753680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29393363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12847520, 18799889, 23209423, 25764157, 27286706, 30098334, 31565031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23209423, 24037182, 25764157, 26464723, 31539147	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	22231733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28035384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19083014, 23430591, 23545584, 28217098, 31621532, 31694925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	19330073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	38277520	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27137184, 29298069, 30414080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27236299		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16831601, 22820139, 28605567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17376806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25207681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	25207681	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	22644781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28144985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31842857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25640370, 28742207, 28770966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	12351404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	22820139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16721726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16055089, 17651480, 19580338, 24932998, 26707189, 28742207, 29326716, 29752723, 30083161, 30787278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20155426, 20433750, 26790955, 28742207, 30453988, 34120621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30617600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17376806, 23824571, 25695729, 26485275, 28328845, 29532409, 30105735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29687843	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25899712, 28144985, 28228755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	12888825	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26393582, 26447993, 28179578, 28328845, 28404963, 30105735, 34238253, 34319031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37536457	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12888825	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25640370, 28742207, 28770966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14617776, 15217536, 16007169, 21042758, 22722483, 30280781, 30280782, 31619584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37329816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21934357, 24593195, 26797799, 36530957, 37762031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28445952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27172798, 28448787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30662576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24184689, 35652342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25682267	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38277520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29317607		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17894941, 25849377, 26432044, 29532409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17894941, 25849377, 26432044, 29532409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31054507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	26464723, 31539147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17241887, 19153483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17241887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17241887, 26485275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29138803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27773939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18656467, 23108375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24883303, 27107422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	18318760, 18815196, 19735488, 23111066, 23430957, 24131863, 24354892, 31255914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24434372, 25535123, 30617600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	23375208, 23910692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23164156		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20631305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21994466, 24367025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17589943, 22467146, 23154639, 30369485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17297444, 21994466, 27171439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19926618, 24098334, 24253664, 24464786, 26482433, 26749281, 28603075, 29662621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21994466, 24098334, 26482433, 28417458, 35184640, 37025997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	19153483, 25744243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	21354254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	22677194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21054677, 24593195, 26797799, 30167088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23545584, 28636181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23545584, 28636181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32870172, 35652342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23545584, 28636181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12171960, 22467146, 28729389, 39199011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25182475, 25997679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21876460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21352802, 22576756, 28296552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26804030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29158586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15008986	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	16685656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	31251775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	12077274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12847520, 15008986, 16685656, 17620093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	29172719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	29172719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15331532, 19118408, 22641569, 25658748, 27137184, 27666763, 31848914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31940889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32752921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15331532, 19118408, 22641569, 25658748, 27137184, 27666763, 29663360, 31848914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22649064, 26095709, 34669152, 36078084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25682267	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34951048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26095709, 27148772, 27611604, 28934129, 30649532, 34001206, 34565450, 36078084, 40080435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15249995, 18648765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15249995, 16920065, 19052638, 21249428, 22649064, 23043161, 26095709, 26823690, 27148772, 27611604, 29110587, 29228585, 30176313, 30414080, 30649532, 31848053, 31848914 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28587386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28639050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22820139, 29228427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29343476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19913854, 25730073, 29599416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	19913854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12847520, 15008986, 16685656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	16804899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	16804899		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20553623	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27172798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27611604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	27611604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	16474852, 30172885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18431520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	33023610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17438093, 18770864, 21590492, 24633048, 30811476, 30990849, 31106423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18770864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24633048, 30811476, 30894197, 35942769, 37315184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17438093, 18770864, 21590492, 24633048, 30811476, 30894197, 30990849, 31106423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21590492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30894197, 34497663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32791747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35731142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25770161, 30474404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	17376806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17376806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	26095709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	BEFREE	30763670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	38212812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26393582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	22147985, 28179578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	17318196, 19231005, 27875997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	16299039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30260985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	28857282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15331532, 28713982, 29030784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	22500980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25888955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	38277520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27611604, 34840983, 38277520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30176313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	23110240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	23110240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18986700	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33191336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	26828667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31341036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24551275, 31952466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	12847520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	LHGDN	12847520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24184689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23596301, 30649532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19535621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25377316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29158586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	16402267, 17993646, 19755625, 19913854, 22344199, 25888955, 27611604, 37453092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	29550470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15385932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	15385932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23108375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30877184		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	22644781		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23430957, 27516205, 28742207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28742207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20575043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15069015, 18318760, 20575043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	23133602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30261716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16007195, 16474852, 16618406, 16831601, 17001312, 17935223, 19803812, 21361790, 21835849, 23430705, 26393582, 26447993, 26794444, 27391584, 28179578 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16831601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18752121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23164156, 28951980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28179578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	38167341	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	12547716	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	17376806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17935223, 21835849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14617776, 15217536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14617776, 18507841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31619584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18820827, 27781323, 30767092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	LHGDN	18538318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20155426, 29970682	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23824571, 28448787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29228427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29228427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16939500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15561778, 22820139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22820139, 30470842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30470842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11159537, 15618960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	31577659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	27107422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28326931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	17376806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	23432547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16055089, 17651480, 19580338, 24932998, 26707189, 28742207, 29326716, 29752723, 30083161, 30787278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21835849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14617776, 15217536, 16007169, 21042758, 22722483, 30280781, 30280782, 31619584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30261716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28448787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21481788, 24996521, 26847351, 29687843, 30388621, 31298410, 31486490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17148681, 18045952, 19738059, 20717995, 24607843, 25899712, 27053681, 27801727, 28144985, 28622443, 30607005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23178499, 23824571, 25261987, 27160093, 29658372, 29970682, 31773681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19638576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25640370, 28742207, 28770966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14617776, 15361843, 16644104, 17935223, 19153483, 19926618, 19951849, 20717995, 21042758, 24098334, 24633048, 24996521, 25377316, 25640370, 25899712 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17894941, 25849377, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17297444, 21994466, 27171439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29868503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15361843, 16055089, 17636039, 19115200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial dysostosis	Pubtator	39596180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23432547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28035977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28035977	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17273770, 17374732, 20398276, 21876460, 30326165		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17273770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17374732, 17579625, 20398276, 30326165, 36202232, 37296634, 37384650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	14617776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27987139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30414080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36609306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27564309, 27611604, 30255772, 34780523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17668875, 27564309, 27611604, 30176313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	31621532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35861833	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20574050, 21934357, 22929979, 37775746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21934357, 22929979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18200504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24951315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	11159537, 35226171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	26408680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12351404, 15607366, 24969884, 27516205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	12351404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18815196, 19229050, 19735488, 23111066, 23430957, 24354892, 27516205, 31255914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	18815196, 19735488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23185530, 29392420, 29643704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	23185530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29049183, 31739782, 33191336, 35675985, 37891664, 38277520, 40760666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	33191336, 38277520	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22761857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22959364, 23375208, 23910692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22231733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15385932, 15618960, 16007169, 17148681, 17241887, 17374732, 17376806, 17438093, 17935223, 18555475, 18770864, 19190337, 19524687, 19738059, 20717995 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	22252769, 26828667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	22252769, 26828667, 33785019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16971535, 18055217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22685291, 29732971, 31273781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	23133602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	23133602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29550470, 31013265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15217536, 21042758, 22722483, 29383133, 30105735, 30280781, 31619584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	26828667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16299039, 16402267, 16822822, 17445271, 17937601, 19083014, 20819948, 21892197, 22093833, 22951153, 24461080, 24932998, 27564309, 27611604, 27704310 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16299039	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19083014, 19717488, 19913854, 21543429, 21892197, 23900445, 27564309, 27611604, 27773939, 27826092, 30397228, 34840983, 35631263, 35712246, 36145200, 36609306, 37721003 View all (2 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	36145200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	25207681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21352802	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	25151085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21538317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteomyelitis	Osteomyelitis	Pubtator	35711689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30487798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23329517, 29568943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24489959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34691358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28448787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28448787, 31773696, 36943460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21481788, 24996521, 26847351, 29687843, 30388621, 31298410, 31486490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21481788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29687843, 31298410, 31486490, 40244037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28643757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15572854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31669235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	27564309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29163477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36456933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	16215461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28314594, 31514318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	BEFREE	22641569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17895321, 30463907, 30590569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22344199	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	19735488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	16781479, 18815196, 19735488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	17325857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19735488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29172719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	29172719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	34349769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31577659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	18815196, 26408680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17148681, 18045952, 19738059, 20717995, 24607843, 25899712, 27053681, 27801727, 28144985, 28622443, 30607005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	34606081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17148681, 18045952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17148681, 19342366, 27053681, 28622443, 31828111, 37646261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	31385476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	35226171	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	22677194, 24461080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12077274, 17620093, 22739986		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35960497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25535123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25535123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21054677, 24593195, 30167088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	22266116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27494343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	28558309, 31031749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11748261, 17726036, 18820827, 20690084, 22576756, 28914550, 29394098, 30854695, 31123968, 31455730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	18240972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31545397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23046072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31484735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26190521, 28625915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	16482545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	11159537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	11159537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24827536, 29655283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22294695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28445952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25695729, 30688657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25695729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	30487798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16007169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26432044, 27367272, 27581787, 28445952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23028842, 24321173, 27367272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16007169, 23028842, 24337411, 27977878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27611604, 28013147, 29550470, 31013265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23178499, 23824571, 25261987, 27160093, 29658372, 29970682, 31773681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23178499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23824571, 27160093, 29970682, 31773681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38277520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	28914550		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	15618960, 27275540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	26990535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	18623127, 18815196, 26990535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	38277520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25770161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28643757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19638576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28643757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19638576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25640370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24531711, 29752723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17589943, 19926618, 25182475, 25545374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17589943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25640370, 28742207, 28770966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19951849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	34670303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17894941, 25849377, 29532409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36690663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26746987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25125049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Very long chain acyl-CoA dehydrogenase deficiency	Acyl CoA Dehydrogenase Deficiency	BEFREE	22093833		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	22677194		★★★★★ ★☆☆☆☆ Found in Text Mining only

SOCS3 (suppressor of cytokine signaling 3)