SNX25 (sorting nexin 25)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83891
Gene name Sorting nexin 25
Gene symbol SNX25
Synonyms (NCBI Gene)
LRP2BP-AS1MSTP043SBBI31
Chromosome 4
Chromosome location 4q35.1
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019745 hsa-miR-375 Microarray 20215506
MIRT726477 hsa-miR-27a-3p HITS-CLIP 22473208
MIRT726476 hsa-miR-27b-3p HITS-CLIP 22473208
MIRT2335569 hsa-miR-664 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005768 Component Endosome IBA
GO:0005768 Component Endosome IEA
GO:0010008 Component Endosome membrane IEA
GO:0015031 Process Protein transport IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620961 21883 ENSG00000109762
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H3E2
Protein name Sorting nexin-25
Protein function May be involved in several stages of intracellular trafficking.
PDB 5WOE , 7SR1 , 7SR2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 287 → 400 Regulator of G protein signaling domain Domain
PF00787 PX 540 → 624 PX domain Domain
PF02194 PXA 1 → 159 PXA domain Family
PF08628 Nexin_C 701 → 807 Sorting nexin C terminal Family
Sequence 
MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVC
NDVVRTLLTHFCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKD
VQSLSLRIMLAEILTTKVLKPVVELLSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSY
EDFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNM
KRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGPQSQKILQFEDILANTFYREH
FGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQ
QCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMG
PRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLK
DEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVG
GVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNK
FLQNLLSDERLCQSEALYAFLSPSPDYLKVIDVQGKKNSFSLSSFLERLPRDFFSHQEEE
TEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINK
QIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIP
DMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV
Sequence length 840
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
SNX25-related autism spectrum disorder Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Epilepsy Epilepsy BEFREE 23518199
★★★★★
★☆☆☆☆
Found in Text Mining only
Epilepsy, Temporal Lobe Epilepsy BEFREE 23518199
★★★★★
★☆☆☆☆
Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral Facioscapulohumeral muscular dystrophy Pubtator 19888305 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for SNX25.

No additional diseases found yet through genes similar to SNX25.