SNX12 (sorting nexin 12)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 29934
• Gene name: Sorting nexin 12
• Gene symbol: SNX12
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like

miRNA Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020105	hsa-miR-130b-3p	Sequencing	20371350
MIRT022294	hsa-miR-124-3p	Microarray	18668037
MIRT025315	hsa-miR-34a-5p	Sequencing	20371350
MIRT031489	hsa-miR-16-5p	Proteomics	18668040
MIRT052243	hsa-let-7b-5p	CLASH	23622248
MIRT050375	hsa-miR-24-3p	CLASH	23622248
MIRT043791	hsa-miR-328-3p	CLASH	23622248
MIRT036369	hsa-miR-1229-3p	CLASH	23622248
MIRT709856	hsa-miR-548ae-3p	HITS-CLIP	19536157
MIRT709855	hsa-miR-548ah-3p	HITS-CLIP	19536157
MIRT709854	hsa-miR-548aj-3p	HITS-CLIP	19536157
MIRT709853	hsa-miR-548am-3p	HITS-CLIP	19536157
MIRT709852	hsa-miR-548aq-3p	HITS-CLIP	19536157
MIRT709851	hsa-miR-548j-3p	HITS-CLIP	19536157
MIRT709850	hsa-miR-548x-3p	HITS-CLIP	19536157
MIRT709849	hsa-miR-548p	HITS-CLIP	19536157
MIRT259746	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT259744	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT259747	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT259750	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT259751	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT709848	hsa-miR-3616-3p	HITS-CLIP	19536157
MIRT709847	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT709846	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT709845	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT709844	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT709843	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT709842	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT709856	hsa-miR-548ae-3p	HITS-CLIP	19536157
MIRT709855	hsa-miR-548ah-3p	HITS-CLIP	19536157
MIRT709854	hsa-miR-548aj-3p	HITS-CLIP	19536157
MIRT709853	hsa-miR-548am-3p	HITS-CLIP	19536157
MIRT709852	hsa-miR-548aq-3p	HITS-CLIP	19536157
MIRT709851	hsa-miR-548j-3p	HITS-CLIP	19536157
MIRT709850	hsa-miR-548x-3p	HITS-CLIP	19536157
MIRT709849	hsa-miR-548p	HITS-CLIP	19536157
MIRT259746	hsa-miR-4436b-3p	HITS-CLIP	19536157
MIRT259744	hsa-miR-4632-5p	HITS-CLIP	19536157
MIRT259747	hsa-miR-6735-5p	HITS-CLIP	19536157
MIRT259750	hsa-miR-6879-5p	HITS-CLIP	19536157
MIRT259751	hsa-miR-7843-5p	HITS-CLIP	19536157
MIRT709848	hsa-miR-3616-3p	HITS-CLIP	19536157
MIRT709847	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT709846	hsa-miR-210-5p	HITS-CLIP	19536157
MIRT709845	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT709844	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT709843	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT709842	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT1376788	hsa-miR-214	CLIP-seq
MIRT1376789	hsa-miR-3188	CLIP-seq
MIRT1376790	hsa-miR-3591-5p	CLIP-seq
MIRT1376791	hsa-miR-3619-5p	CLIP-seq
MIRT1376792	hsa-miR-3665	CLIP-seq
MIRT1376793	hsa-miR-4280	CLIP-seq
MIRT1376794	hsa-miR-4291	CLIP-seq
MIRT1376795	hsa-miR-4710	CLIP-seq
MIRT1376796	hsa-miR-4736	CLIP-seq
MIRT1376797	hsa-miR-4792	CLIP-seq
MIRT1376798	hsa-miR-548aa	CLIP-seq
MIRT1376799	hsa-miR-548ac	CLIP-seq
MIRT1376800	hsa-miR-548ae	CLIP-seq
MIRT1376801	hsa-miR-548aj	CLIP-seq
MIRT1376802	hsa-miR-548am	CLIP-seq
MIRT1376803	hsa-miR-548d-3p	CLIP-seq
MIRT1376804	hsa-miR-548x	CLIP-seq
MIRT1376805	hsa-miR-548z	CLIP-seq
MIRT1376806	hsa-miR-616	CLIP-seq
MIRT1376807	hsa-miR-761	CLIP-seq
MIRT1376808	hsa-miR-922	CLIP-seq
MIRT1376788	hsa-miR-214	CLIP-seq
MIRT1376791	hsa-miR-3619-5p	CLIP-seq
MIRT1376794	hsa-miR-4291	CLIP-seq
MIRT1376806	hsa-miR-616	CLIP-seq
MIRT1376807	hsa-miR-761	CLIP-seq
MIRT1376808	hsa-miR-922	CLIP-seq
MIRT1376788	hsa-miR-214	CLIP-seq
MIRT1376791	hsa-miR-3619-5p	CLIP-seq
MIRT1376794	hsa-miR-4291	CLIP-seq
MIRT1376806	hsa-miR-616	CLIP-seq
MIRT1376807	hsa-miR-761	CLIP-seq
MIRT1376808	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17474147, 22719997, 25416956, 32296183, 32814053
GO:0005769	Component	Early endosome	IDA	22709416, 22719997
GO:0008289	Function	Lipid binding	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	22709416
GO:0010955	Process	Negative regulation of protein processing	IDA	22709416
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IPI	22709416
GO:0030100	Process	Regulation of endocytosis	IMP	22709416
GO:0030904	Component	Retromer complex	IBA
GO:0031901	Component	Early endosome membrane	IBA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IBA
GO:0032456	Process	Endocytic recycling	IBA
GO:0034499	Process	Late endosome to Golgi transport	IBA
GO:0035091	Function	Phosphatidylinositol binding	IDA	22719997
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	22719997
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0051224	Process	Negative regulation of protein transport	IDA	22719997
GO:0051224	Process	Negative regulation of protein transport	IEA
GO:2000642	Process	Negative regulation of early endosome to late endosome transport	IDA	22719997
GO:2000642	Process	Negative regulation of early endosome to late endosome transport	IEA

Other IDs

• MIM: 300883
• HGNC: 14976
• e!Ensembl: ENSG00000147164

Protein

• UniProt ID: Q9UMY4
• Protein name: Sorting nexin-12
• Protein function: May be involved in several stages of intracellular trafficking.
• PDB: 2CSK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00787	PX	58 → 149	PX domain	Domain

• Sequence:

  MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
  FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
  QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ

• Sequence length: 162

Pathways

KEGG Pathway:

Endocytosis

Related Genes

No strongly related genes found yet for SNX12.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SNX12.