SNURFL (SNRPN upstream open reading frame like (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 727686
Gene name SNRPN upstream open reading frame like (pseudogene)
Gene symbol SNURFL
Synonyms (NCBI Gene)
CXorf19
Chromosome X
Chromosome location Xq27.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0016607 Component Nuclear speck IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 29543 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B1AK76
Protein name Putative SNURF-like protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07192 SNURF 2 → 69 SNURF/RPN4 protein Family
Sequence 
MEQARDHLHLRWTTEQHMPEVEVQVKYRTAALSNQECQLYLRHSQQQQVLVVDFQAKLRQ
VFITETPRCGKKPYWNNEEAESKQNPGSIYCLLLLIRGGMSDSLIKREISNFEIVSKNKK
N
Sequence length 121
Interactions View interactions

No strongly related genes found yet for SNURFL.

No additional diseases found yet through genes similar to SNURFL.