Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	100130932
Gene name	Small nuclear ribonucleoprotein polypeptide G pseudogene 15
Gene symbol	SNRPGP15
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19p13.12

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005682	Component	U5 snRNP	IBA
GO:0005685	Component	U1 snRNP	IBA
GO:0005686	Component	U2 snRNP	IBA
GO:0005687	Component	U4 snRNP	IBA
GO:0005689	Component	U12-type spliceosomal complex	IBA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0030532	Component	Small nuclear ribonucleoprotein complex	IEA
GO:0034719	Component	SMN-Sm protein complex	IBA
GO:0043186	Component	P granule	IBA
GO:0071004	Component	U2-type prespliceosome	IBA
GO:0071011	Component	Precatalytic spliceosome	IBA
GO:0071013	Component	Catalytic step 2 spliceosome	IBA
GO:0097526	Component	Spliceosomal tri-snRNP complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
HGNC	49371	N/A

Protein name

Putative small nuclear ribonucleoprotein G-like protein 15

Protein function

Associated with snRNP U1, U2, U4/U6 and U5.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01423	LSM	7 → 72	LSM domain	Domain

Sequence

MSKAHPPELKKFTDKKFSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQKNIGMV
EIRGNSIIMLEALERV

Sequence length

Interactions

View interactions

Related Genes Genes most often co-reported with SNRPGP15 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SNRPGP15.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SNRPGP15 (see Related Genes above), that are NOT already directly curated for SNRPGP15 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SNRPGP15.

SNRPGP15 (small nuclear ribonucleoprotein polypeptide G pseudogene 15)