SNHG28 (small nucleolar RNA host gene 28)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 284677 |
| Gene name | Small nucleolar RNA host gene 28 |
| Gene symbol | SNHG28 |
| Synonyms (NCBI Gene) |
C1orf204VSIG8-OT1
|
| Chromosome | 1 |
| Chromosome location | 1q23.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0DPA3 |
| Protein name | Putative uncharacterized protein SNHG28 (Small nucleolar RNA host gene 2) (VSIG8 overlapping transcript protein) (VSIG8-OT1) |
| Family and domains | |
| Sequence |
MGMLAPGPLQGRRPRKGHKGQEDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPP |
| Sequence length | 235 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SNHG28 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SNHG28 (see Related Genes above), that are NOT already directly curated for SNHG28 itself -- a lead worth checking, not a confirmed association.
0
|
|