SNHG12 (small nucleolar RNA host gene 12)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85028
Gene name Small nucleolar RNA host gene 12
Gene symbol SNHG12
Synonyms (NCBI Gene)
ASLNC04080C1orf79LINC00100NCRNA00100PNAS-123
Chromosome 1
Chromosome location 1p35.3
Summary This gene produces a long RNA that is overexpressed in tumor cells. This RNA may promote tumorigenesis by acting as a sponge for microRNAs. [provided by RefSeq, Dec 2017]
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT732605 hsa-miR-320b Luciferase reporter assayqRT-PCR 32432698
MIRT732700 hsa-let-7e-5p Luciferase reporter assayqRT-PCR 33630421
MIRT756097 hsa-miR-603 Luciferase reporter assayqRT-PCR 38234617
MIRT756158 hsa-miR-140-3p Luciferase reporter assayWestern blotting 37346408
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005730 Component Nucleolus IEA
GO:0006396 Process RNA processing IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXW3
Protein name Putative uncharacterized protein SNHG12 (Transformation-related gene 11 protein) (TRG-11)
Family and domains
Sequence 
MQGTWLPPSFLAVCDTEEVSLFLELCFKIHVTCKAVLICDYGPMELGQSLWEAEGKDPGH
FR
Sequence length 62
Interactions View interactions

No strongly related genes found yet for SNHG12.

No additional diseases found yet through genes similar to SNHG12.