SND1-IT1 (SND1 intronic transcript 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 27099 |
| Gene name | SND1 intronic transcript 1 |
| Gene symbol | SND1-IT1 |
| Synonyms (NCBI Gene) |
C7orf54NAG8NSG-X
|
| Chromosome | 7 |
| Chromosome location | 7q32.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9HBX3 |
| Protein name | Uncharacterized protein encoded by SND1-IT1 (Brain and nasopharyngeal carcinoma susceptibility protein NSG-x) (Nasopharyngeal carcinoma-associated gene 8 protein) (SND1 intronic transcript 1) |
| Family and domains | |
| Sequence |
MSHHPHSLRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSLLFW |
| Sequence length | 110 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SND1-IT1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SND1-IT1 (see Related Genes above), that are NOT already directly curated for SND1-IT1 itself -- a lead worth checking, not a confirmed association.
0
|
|