SNAI2 (snail family transcriptional repressor 2)

Gene

• Entrez ID: 6591
• Gene name: Snail family transcriptional repressor 2
• Gene symbol: SNAI2
• Synonyms (NCBI Gene): SLUG, SLUGH, SLUGH1, SNAIL2, WS2D
• Chromosome: 8
• Chromosome location: 8q11.21
• Summary: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. T

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT002716	hsa-miR-124-3p	Microarray	15685193
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22253443
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Luciferase reporter assay	22262409
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT002716	hsa-miR-124-3p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23250910
MIRT007214	hsa-miR-1-3p	Flow, Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23142026
MIRT007214	hsa-miR-1-3p	Flow, Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	23142026
MIRT007226	hsa-miR-182-5p	Luciferase reporter assay	23354685
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	23354685
MIRT007240	hsa-miR-545-3p	Luciferase reporter assay	23434592
MIRT007240	hsa-miR-545-3p	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23434592
MIRT007241	hsa-miR-630	Luciferase reporter assay	23435373
MIRT019445	hsa-miR-148b-3p	Microarray	17612493
MIRT021454	hsa-miR-9-5p	Microarray	17612493
MIRT021687	hsa-miR-138-5p	Western blot;qRT-PCR	21770894
MIRT002716	hsa-miR-124-3p	Microarray	18668037
MIRT002716	hsa-miR-124-3p	Microarray	15685193
MIRT025178	hsa-miR-181a-5p	Microarray	17612493
MIRT054184	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25707493
MIRT054282	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	23717581
MIRT054282	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	23717581
MIRT054655	hsa-miR-183-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT054656	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT007214	hsa-miR-1-3p	Immunofluorescence, Immunohistochemistry, qRT-PCR, Western blot	24760686
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT438640	hsa-miR-30c-5p	Luciferase reporter assay	24112779
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT439577	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439577	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT731608	hsa-miR-489-3p	Luciferase reporter assay	26918943
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26194864
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26194864
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	25871397
MIRT007227	hsa-miR-203a-3p	Luciferase reporter assay	25871397
MIRT007227	hsa-miR-203a-3p	qRT-PCR, Western blot	28269747
MIRT734121	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31570789
MIRT003273	hsa-miR-204-5p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31938073
MIRT737441	hsa-miR-200b-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	31749661
MIRT737442	hsa-miR-30c-1-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	31749661
MIRT737443	hsa-miR-363-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	31749661
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT636219	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT636217	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT636218	hsa-miR-4287	HITS-CLIP	23824327
MIRT636216	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT003273	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT636215	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT636214	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT636213	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT636212	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT636211	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT636210	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT448216	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448215	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448214	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448213	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448212	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448211	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448210	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448209	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448208	hsa-miR-5701	PAR-CLIP	22100165
MIRT755659	hsa-miR-203b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37601756
MIRT755924	hsa-miR-429	Luciferase reporter assay, Western blotting, qRT-PCR	34966442
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT1374796	hsa-miR-3065-5p	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT1374800	hsa-miR-421	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq
MIRT1553874	hsa-miR-4795-3p	CLIP-seq
MIRT1553875	hsa-miR-656	CLIP-seq
MIRT2334640	hsa-miR-3662	CLIP-seq
MIRT2334641	hsa-miR-4477a	CLIP-seq
MIRT2334642	hsa-miR-4693-5p	CLIP-seq
MIRT2334643	hsa-miR-944	CLIP-seq
MIRT2433339	hsa-miR-1284	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT2628670	hsa-miR-1236	CLIP-seq
MIRT2628671	hsa-miR-124	CLIP-seq
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT2628672	hsa-miR-200b	CLIP-seq
MIRT2628673	hsa-miR-200c	CLIP-seq
MIRT2628674	hsa-miR-203	CLIP-seq
MIRT2628675	hsa-miR-2116	CLIP-seq
MIRT2628676	hsa-miR-218	CLIP-seq
MIRT2628677	hsa-miR-3128	CLIP-seq
MIRT2628678	hsa-miR-3153	CLIP-seq
MIRT2628679	hsa-miR-330-3p	CLIP-seq
MIRT2628680	hsa-miR-337-3p	CLIP-seq
MIRT2628681	hsa-miR-33a	CLIP-seq
MIRT2628682	hsa-miR-33b	CLIP-seq
MIRT2628683	hsa-miR-3622a-3p	CLIP-seq
MIRT2628684	hsa-miR-3622b-3p	CLIP-seq
MIRT2628685	hsa-miR-3673	CLIP-seq
MIRT2628686	hsa-miR-3714	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT2628687	hsa-miR-3910	CLIP-seq
MIRT2628688	hsa-miR-3942-5p	CLIP-seq
MIRT755924	hsa-miR-429	CLIP-seq
MIRT2628689	hsa-miR-4476	CLIP-seq
MIRT2628690	hsa-miR-4477b	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT2628691	hsa-miR-452	CLIP-seq
MIRT2628692	hsa-miR-4668-5p	CLIP-seq
MIRT2628693	hsa-miR-4676-3p	CLIP-seq
MIRT2628694	hsa-miR-4677-5p	CLIP-seq
MIRT2628695	hsa-miR-4682	CLIP-seq
MIRT2628696	hsa-miR-4703-5p	CLIP-seq
MIRT2628697	hsa-miR-4720-5p	CLIP-seq
MIRT2628698	hsa-miR-4799-3p	CLIP-seq
MIRT2628699	hsa-miR-506	CLIP-seq
MIRT2628700	hsa-miR-520d-5p	CLIP-seq
MIRT2628701	hsa-miR-524-5p	CLIP-seq
MIRT2628702	hsa-miR-636	CLIP-seq
MIRT2628703	hsa-miR-651	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT2628704	hsa-miR-890	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq
MIRT2628671	hsa-miR-124	CLIP-seq
MIRT1374793	hsa-miR-1271	CLIP-seq
MIRT2433339	hsa-miR-1284	CLIP-seq
MIRT2691568	hsa-miR-137	CLIP-seq
MIRT1374794	hsa-miR-182	CLIP-seq
MIRT2628672	hsa-miR-200b	CLIP-seq
MIRT2628673	hsa-miR-200c	CLIP-seq
MIRT2628674	hsa-miR-203	CLIP-seq
MIRT2628675	hsa-miR-2116	CLIP-seq
MIRT2628676	hsa-miR-218	CLIP-seq
MIRT2691569	hsa-miR-25	CLIP-seq
MIRT1374795	hsa-miR-300	CLIP-seq
MIRT2628677	hsa-miR-3128	CLIP-seq
MIRT2691570	hsa-miR-3140-3p	CLIP-seq
MIRT2691571	hsa-miR-3179	CLIP-seq
MIRT2691572	hsa-miR-32	CLIP-seq
MIRT2691573	hsa-miR-3202	CLIP-seq
MIRT2691574	hsa-miR-323-3p	CLIP-seq
MIRT2628679	hsa-miR-330-3p	CLIP-seq
MIRT2628681	hsa-miR-33a	CLIP-seq
MIRT2628682	hsa-miR-33b	CLIP-seq
MIRT2691575	hsa-miR-3614-5p	CLIP-seq
MIRT2628683	hsa-miR-3622a-3p	CLIP-seq
MIRT2628684	hsa-miR-3622b-3p	CLIP-seq
MIRT2691576	hsa-miR-363	CLIP-seq
MIRT2691577	hsa-miR-367	CLIP-seq
MIRT2628685	hsa-miR-3673	CLIP-seq
MIRT2628686	hsa-miR-3714	CLIP-seq
MIRT1374797	hsa-miR-380	CLIP-seq
MIRT1374798	hsa-miR-381	CLIP-seq
MIRT1374799	hsa-miR-3908	CLIP-seq
MIRT2628687	hsa-miR-3910	CLIP-seq
MIRT2691578	hsa-miR-3936	CLIP-seq
MIRT2628688	hsa-miR-3942-5p	CLIP-seq
MIRT755924	hsa-miR-429	CLIP-seq
MIRT2628689	hsa-miR-4476	CLIP-seq
MIRT2628690	hsa-miR-4477b	CLIP-seq
MIRT1374801	hsa-miR-4495	CLIP-seq
MIRT2628691	hsa-miR-452	CLIP-seq
MIRT2691579	hsa-miR-4533	CLIP-seq
MIRT2691580	hsa-miR-4536	CLIP-seq
MIRT1374802	hsa-miR-4666-3p	CLIP-seq
MIRT2628693	hsa-miR-4676-3p	CLIP-seq
MIRT2628694	hsa-miR-4677-5p	CLIP-seq
MIRT2628695	hsa-miR-4682	CLIP-seq
MIRT2628696	hsa-miR-4703-5p	CLIP-seq
MIRT2628697	hsa-miR-4720-5p	CLIP-seq
MIRT1553874	hsa-miR-4795-3p	CLIP-seq
MIRT2628698	hsa-miR-4799-3p	CLIP-seq
MIRT2628699	hsa-miR-506	CLIP-seq
MIRT2628700	hsa-miR-520d-5p	CLIP-seq
MIRT2628701	hsa-miR-524-5p	CLIP-seq
MIRT2691581	hsa-miR-548an	CLIP-seq
MIRT2691582	hsa-miR-579	CLIP-seq
MIRT2691583	hsa-miR-586	CLIP-seq
MIRT2628702	hsa-miR-636	CLIP-seq
MIRT2628703	hsa-miR-651	CLIP-seq
MIRT1374803	hsa-miR-885-3p	CLIP-seq
MIRT2628704	hsa-miR-890	CLIP-seq
MIRT2691584	hsa-miR-92a	CLIP-seq
MIRT2691585	hsa-miR-92b	CLIP-seq
MIRT1374804	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Repression	15955695
ESRRA	Repression	15955695
EZH2	Repression	23836662
HDAC1	Repression	18588516
HDAC2	Repression	23836662
LEF1	Unknown	20128911
MTA1	Activation	18719363
NCOR1	Repression	18588516
PER2	Repression	23836662
POU2F1	Activation	23836662
POU2F1	Repression	23836662
RUNX2	Activation	22641097
SUZ12	Repression	23836662
TCF7	Unknown	20128911
TCF7L2	Unknown	20128911
WT1	Unknown	17430890

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10866665, 11912130, 15737616, 16707493
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17984306, 18663143
GO:0000785	Component	Chromatin	IDA	16707493, 19756381
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11912130
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10866665, 11912130, 15737616, 16707493, 18663143
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	IEP	20128911
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IMP	9182671, 17984306
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003273	Process	Cell migration involved in endocardial cushion formation	IEA
GO:0003273	Process	Cell migration involved in endocardial cushion formation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IDA	10866665, 25893292, 29910125
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0006933	Process	Negative regulation of cell adhesion involved in substrate-bound cell migration	IEA
GO:0007219	Process	Notch signaling pathway	IMP	18663143
GO:0007219	Process	Notch signaling pathway	TAS	20951801
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	12444107
GO:0008270	Function	Zinc ion binding	IEA
GO:0009314	Process	Response to radiation	IEA
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IDA	16707493
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	18485278, 19502595
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IEA
GO:0014032	Process	Neural crest cell development	IMP	12444107
GO:0030335	Process	Positive regulation of cell migration	IMP	15314165
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IMP	19756381
GO:0032642	Process	Regulation of chemokine production	IMP	21182836
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033629	Process	Negative regulation of cell adhesion mediated by integrin	IDA	16707493
GO:0035921	Process	Desmosome disassembly	IEA
GO:0035921	Process	Desmosome disassembly	IMP	9182671
GO:0043473	Process	Pigmentation	IEA
GO:0043473	Process	Pigmentation	IMP	12444107
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	15314165
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	10518215, 10866665
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045667	Process	Regulation of osteoblast differentiation	IMP	19756381, 21182836
GO:0046872	Function	Metal ion binding	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060429	Process	Epithelium development	IEA
GO:0060429	Process	Epithelium development	ISS	18716062
GO:0060536	Process	Cartilage morphogenesis	IEA
GO:0060693	Process	Regulation of branching involved in salivary gland morphogenesis	IEA
GO:0070563	Process	Negative regulation of vitamin D receptor signaling pathway	IDA	19502595
GO:0070888	Function	E-box binding	IDA	11912130, 15737616, 16707493
GO:0070888	Function	E-box binding	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	18716062
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	19502595
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	19756381
GO:1902034	Process	Negative regulation of hematopoietic stem cell proliferation	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15314165
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	15314165
GO:2000811	Process	Negative regulation of anoikis	IMP	17984306
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISS	10518215

Other IDs

• MIM: 602150
• HGNC: 11094
• e!Ensembl: ENSG00000019549

Protein

• UniProt ID: O43623
• Protein name: Zinc finger protein SNAI2 (Neural crest transcription factor Slug) (Protein snail homolog 2)
• Protein function: Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occlu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	128 → 150	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	159 → 181	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	185 → 207	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	213 → 235	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	241 → 262	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Ex
• Sequence:

  MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
  TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
  HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
  HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
  YQCKNCSKTFSRMSLLHKHEESGCCVAH

• Sequence length: 268

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SNAI2-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, PAPILLARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAARDENBURG SYNDROME	—	ClinGen, ClinVar, Disgenet ClinGen, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAARDENBURG SYNDROME TYPE 2	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAARDENBURG SYNDROME TYPE 2D	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAARDENBURG SYNDROME, TYPE IID	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Absent pigmentation of the ventral chest	Absent pigmentation of the ventral chest	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23456319, 25686823, 26496316		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27191723		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27323831		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25409617		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38016947	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26496316		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27029493, 30368884		★☆☆☆☆ Found in Text Mining only
Anomalous pulmonary artery	Anomalous Pulmonary Artery	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	37832352	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25633317, 27875740		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20418652	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26654598	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25633317, 27875740		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34329656	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35607269	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29484431		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27191723		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	20863401	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23157797	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31652994		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11850205		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11912130, 15734731, 18089802, 20509143, 20890129, 21044962, 22496452, 22992620, 23031797, 26096931, 26124343, 27029493, 27181204, 27748910, 28135249, 29774079, 29921289, 30823890, 30844311, 31235819		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15737616, 15742334, 16773075, 18485278, 19604397, 20010940, 20509143, 21044962, 22028892, 22151997, 22496452, 23011797, 23031797, 23721519, 24036252, 24934762, 25053741, 25086032, 25277187, 25645291, 25645984, 25733818, 26781944, 27081041, 27127545, 28107418, 28334049, 28371195, 28500896, 28867731, 29921289, 30189837, 30954555, 31481735, 31987042, 32043610, 32943575, 32943576, 35381768, 36384125, 36431925, 37117180	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31681835	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	23475579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29397868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11912130, 20043117, 26496316, 29389061		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	32661742	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25885343, 26349748, 27181103, 27540976, 28946551	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	20509143, 24870796	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	19751508, 25645984	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27102441, 31685543, 32901858, 34338154, 35345355, 37138218, 37596321	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	25413006	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23244088, 23339680, 23434592, 30251328, 30612578		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28097141, 32681294, 36375842	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18766116, 30791220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21808237	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22363672, 26036633, 26261509, 27297979, 31658319, 36536414, 36766694	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24112779, 32124963	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25413006	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20150431, 24870796, 27081041, 28338201, 31886179, 32784485, 35763651	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27138192	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24870796		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28039463, 29041931, 29929545, 31165775		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19389926	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26124343		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	38016947	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27036045		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27036045		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20503457, 24280681, 24816558, 37369494	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21120639, 21339993		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	24760686		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	24760686	Associate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	31144750		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19502595, 20138990, 25249558, 29462209		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25249558, 26619963, 27259250, 27836787, 30541610, 31653342		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16773075, 19502595, 20138990, 20562906, 23996472, 25249558, 25750173, 25846868, 26379394, 27315462, 29202800, 29504907, 30531836, 30917533, 32107843, 32331534, 34199046, 35681502, 36362141, 37933160, 37973787, 38522060, 39239548	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19502595, 20138990		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	24127225	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26261509, 30772441, 31545257		★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	25947161		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27113480	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	28415643	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33053534	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	17973239		★☆☆☆☆ Found in Text Mining only
Ductus Arteriosus Patent	Patent ductus arteriosus	Pubtator	18766116	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	21785273	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31220580		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23114646, 26868332, 27449470, 29080395, 37169340	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26367784, 33457409	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26198055		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26198055, 35616875	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	35145202	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	22749188		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29393450		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	17068819		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25322669, 34160902	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16773075, 24367561, 26370982, 31324391	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	24367561	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	28179411		★☆☆☆☆ Found in Text Mining only
Familial Nonmedullary Thyroid Cancer	Thyroid cancer	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34913073	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	28334729, 31749661		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	28334729, 33603171	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16142376, 20565806, 25871397, 28351300, 29844871, 31652994		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22493711, 23482671, 25871397, 26654598, 28351300, 32705169	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16142376, 20565806, 25871397, 28351300, 31652994		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20565806, 22253443, 25605251, 31011939		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20646316, 37408388, 40604866	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	22288519	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	16717446		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33457409	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34382739, 34768995	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29331414		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	20636395		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20010940, 23050024, 24112779, 25096400, 26379394, 30058095, 30612578, 38016947	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29592811	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19850962		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	29074488		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27113480	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31144750		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34510400	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31423278		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26124343		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37569620	Associate	★☆☆☆☆ Found in Text Mining only
Klein`s Syndrome	Klein`s Syndrome	CLINGEN_DG	12444107		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25491625	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	16142376, 20651304		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	20651304	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25555870	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22937066, 24154488, 27651311, 27760172, 28271214, 28280353, 28890291, 30809294, 31432592, 31685543		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25337226, 25413006	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22933707, 23244088, 25120788, 26387547, 28350337, 28487957, 30251328, 30612578, 31271097, 31941995, 32753472, 33744858, 35740931, 36553576	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30209362		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20503457, 24427353, 28974196, 29794474, 33761659, 38522060	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21647877, 23157797, 25645984, 28487957, 33799604, 33817718	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25686823	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31011939		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11850205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11912130, 15734731, 18089802, 20509143, 20890129, 21044962, 22496452, 23031797, 25707493, 26096931, 26124343, 27029493, 27181204, 27748910, 28135249, 29774079, 29921289, 30189837, 30823890, 30844311, 31235819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31220580		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	17068819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23244088, 23339680, 23434592, 30251328, 30612578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28039463, 29041931, 29929545, 31165775		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21909140, 22074556, 22203039, 24648349, 24910389, 25686823, 25728608, 25728945, 27554677, 29389061, 29536528, 29552304, 30065348, 31298493, 31636385, 31712163		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27718152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27878953, 28829503, 30198421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27029493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31364745		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15735690, 17213017, 17641412, 20043117, 21656704, 24260469, 24936451, 25482617, 25728608, 25855378, 26096931, 26124343, 26194471, 27029493, 27718152, 27760172, 29794474, 30051594, 30189837, 30198421, 30649699, 30655734, 30772441, 30809294, 30844311, 30903020, 31570438		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27036045		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19502595, 20138990, 25249558, 29462209		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11850205		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11850205		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11912130, 16169465, 18160708, 19046938		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18160708, 25482617, 26194471, 27029493, 30844311		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11850205		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16204058, 17641412, 20043117, 22911700, 23250725, 24870796, 27718152, 30454887		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17641412, 21593765, 22503751, 22911700, 31171904, 33154524, 36866769	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	24870796		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	15337769		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	15337769, 23886156	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	20506051		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35918485	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34144151	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28574664, 29969465	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28008160, 34738621	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28615628	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25738652		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26934447, 28338201, 31907338, 37563118	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	38065913	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17973239, 18408755, 20043117, 20509143, 22253443, 22777354, 22992620, 23131919, 23257359, 23900394, 24632619, 24916694, 25686823, 25728608, 25738652, 25871397, 26096931, 26514616, 27036045, 27456359, 27760172, 27836787, 28039463, 28209530, 28334729, 29041931, 29229854, 29340043, 29402961, 29552134, 29716922, 29845746, 30241553, 30992462, 31011939, 31226820, 31298493		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29383160		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	10479723		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23407937, 24632619		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	28179411		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30651886, 31344049, 31661137		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22355352	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31220580		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30920079		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25797039	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23352643, 29552134		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31165775		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28039463, 29041931, 29929545		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15742334, 18550773, 22232246, 22429801, 22479527, 23554977, 25944620, 27129169, 27166196, 30628686, 31165775, 33478150, 34363722, 38527595	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	30451796	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19820419, 21678462, 21909380, 22232555, 25409617, 25860483, 36932397, 37251370	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	18766116	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	33457409	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	27818488		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	27818488	Associate	★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	35806108	Associate	★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	12955764, 15735690, 16717446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Piebaldism	ORPHANET_DG	12955764, 24443330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Piebaldism	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Piebaldism	GENOMICS_ENGLAND_DG	9721220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Piebaldism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Piebaldism	Piebaldism	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29844871		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	31291576		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20506051, 21909140, 22074556, 22203039, 24648349, 24910389, 25686823, 25728608, 25728945, 27554677, 29389061, 29536528, 29552304, 30065348, 31298493, 31636385, 31712163		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16541421		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20506051, 22074556, 26540632, 26983806, 27356744, 29206234, 29300772, 30058095, 30754655, 31060254, 31636385, 33174391, 33605548, 33799604, 34322653, 34792282, 36245088, 38065913, 39273616	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25686823	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29389061, 29552304		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30065348, 32124938	Stimulate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28115235		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21808237, 31545257		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	34285060, 37882064	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20418652		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21983934	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	21809991, 33076385	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	26360820	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	32441446	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	18408755		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	31299087	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35263398	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26387547	Associate	★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18408755, 21647877, 24870796, 27718152		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28209530		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21304586, 21647877, 21785273, 22201613, 25762643, 26214683, 26861993, 28574664, 29739791, 29794474, 29969465, 30261040, 31439759, 31861233, 31938073, 32669963, 33340247, 33761659, 33802627, 34382739	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35219646	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26755661, 28488774, 29739791, 29794474		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21647877		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27878953, 28829503, 30198421		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16521229, 28829503, 28974196, 29336198, 30198421, 32329839, 33095806, 34135208, 36457025, 36580668, 36768307	Associate	★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26360820		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	16717446		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24427353, 27845909	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17724139, 27029493		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	22899291, 25755746, 28128736	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27029493		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22641097, 22899291, 31228933, 39179334	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22496452, 25982283, 37342906	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25982283, 29674627		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	29358327		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20809941, 29250666, 29517839, 35763651	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	26841870		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30791220, 37832352	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	37175770	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23226515, 32899940, 36674577, 37175770	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29233905		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	34944071	Associate	★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome	Waardenburg Syndrome	CLINGEN_DG	12444107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg Syndrome	Waardenburg syndrome	Pubtator	25932447, 26781036, 29630160, 30936914, 32908492, 36329483	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg Syndrome	Waardenburg Syndrome	BEFREE	28263850, 31812001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg Syndrome Type 1	Waardenburg Syndrome	CLINGEN_DG	12444107		★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome Type 2	Waardenburg Syndrome	ORPHANET_DG	12444107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg syndrome type 2	Waardenburg Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg Syndrome Type 2	Waardenburg Syndrome	BEFREE	15735690, 16717446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waardenburg syndrome type 2A	Waardenburg syndrome	Pubtator	17999358	Associate	★☆☆☆☆ Found in Text Mining only
WAARDENBURG SYNDROME, TYPE IID	Waardenburg syndrome	GENOMICS_ENGLAND_DG	9721220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAARDENBURG SYNDROME, TYPE IID	Waardenburg syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations