Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6615
Gene name	Snail family transcriptional repressor 1
Gene symbol	SNAI1
Synonyms (NCBI Gene)	SLUGH2SNASNAHSNAILSNAIL1dJ710H13.1
Chromosome	20
Chromosome location	20q13.13
Summary	The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein,

281

Show/Hide all (281)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004651	hsa-miR-204-5p	Luciferase reporter assay	20056717
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006761	hsa-miR-30b-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006761	hsa-miR-30b-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006763	hsa-miR-30d-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006763	hsa-miR-30d-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006764	hsa-miR-30e-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT006764	hsa-miR-30e-5p	Luciferase reporter assayqRT-PCRWestern blot	21633953
MIRT007098	hsa-miR-153-3p	Luciferase reporter assayqRT-PCRWestern blot	23188671
MIRT018418	hsa-miR-335-5p	Microarray	18185580
MIRT022882	hsa-miR-124-3p	Microarray	18668037
MIRT029897	hsa-miR-26b-5p	Microarray	19088304
MIRT052946	hsa-miR-34a-5p	HCT-15 and H1299"	22134354
MIRT052946	hsa-miR-34a-5p	HCT-15 and H1299"	22134354
MIRT052947	hsa-miR-34b-3p	HCT-15 and H1299"	22134354
MIRT052952	hsa-miR-34c-5p	HCT-15 and H1299"	22134354
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	22134354
MIRT007098	hsa-miR-153-3p	ImmunohistochemistryqRT-PCRWestern blot	25678802
MIRT006760	hsa-miR-30a-5p	ImmunohistochemistryLuciferase reporter assayQRTPCRWestern blot	24954667
MIRT006760	hsa-miR-30a-5p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23831330
MIRT006760	hsa-miR-30a-5p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23831330
MIRT437836	hsa-miR-506-3p	ImmunofluorescenceImmunohistochemistryIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23410973
MIRT438895	hsa-miR-203a-3p	ChIP-seqImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23447531
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438895	hsa-miR-203a-3p	ChIP-seqImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23447531
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT438532	hsa-miR-199a-5p	Luciferase reporter assayWestern blot	25041364
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	28145431
MIRT052946	hsa-miR-34a-5p	Luciferase reporter assayWestern blot	28145431
MIRT007098	hsa-miR-153-3p	Luciferase reporter assayqRT-PCRWestern blot	26232914
MIRT007098	hsa-miR-153-3p	Luciferase reporter assayqRT-PCRWestern blot	26232914
MIRT007098	hsa-miR-153-3p	Luciferase reporter assayqRT-PCRWestern blot	28400282
MIRT007098	hsa-miR-153-3p	Luciferase reporter assayqRT-PCRWestern blot	28400282
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assayWestern blot	28222434
MIRT006762	hsa-miR-30c-5p	Luciferase reporter assayWestern blot	28222434
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assayWestern blot	28222434
MIRT006760	hsa-miR-30a-5p	Luciferase reporter assayWestern blot	28222434
MIRT732075	hsa-miR-22-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26610210
MIRT732075	hsa-miR-22-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26610210
MIRT004651	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blot	26729198
MIRT004651	hsa-miR-204-5p	Luciferase reporter assayqRT-PCRWestern blot	26729198
MIRT006606	hsa-miR-30a-5p	FlowqRT-PCRWestern blot	27212164
MIRT052946	hsa-miR-34a-5p	MicroarrayqRT-PCR	33675467
MIRT006760	hsa-miR-30a-5p	qRT-PCRWestern blotting	31772711
MIRT734646	hsa-miR-199b-5p	Luciferase reporter assayqRT-PCR	31705138
MIRT737572	hsa-miR-30a-3p	Western blottingqRT-PCR	31772711
MIRT737577	hsa-miR-29b-3p	MicroarrayImmunofluorescenceqRT-PCR	31482255
MIRT756063	hsa-miR-370-3p	Luciferase reporter assayWestern blottingqRT-PCREMSA	36083239
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT1374757	hsa-miR-1236	CLIP-seq
MIRT1374758	hsa-miR-1253	CLIP-seq
MIRT1374759	hsa-miR-1470	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT1374763	hsa-miR-3187-3p	CLIP-seq
MIRT1374764	hsa-miR-34a	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT1374766	hsa-miR-3664-3p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT1374768	hsa-miR-4290	CLIP-seq
MIRT1374769	hsa-miR-4433	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT1374771	hsa-miR-4469	CLIP-seq
MIRT1374772	hsa-miR-4488	CLIP-seq
MIRT1374773	hsa-miR-4493	CLIP-seq
MIRT1374774	hsa-miR-449a	CLIP-seq
MIRT1374775	hsa-miR-449b	CLIP-seq
MIRT1374776	hsa-miR-4529-5p	CLIP-seq
MIRT1374777	hsa-miR-4640-5p	CLIP-seq
MIRT1374778	hsa-miR-4667-3p	CLIP-seq
MIRT1374779	hsa-miR-4697-5p	CLIP-seq
MIRT1374780	hsa-miR-4726-5p	CLIP-seq
MIRT1374781	hsa-miR-4731-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT1374783	hsa-miR-4757-5p	CLIP-seq
MIRT1374784	hsa-miR-4768-3p	CLIP-seq
MIRT1374785	hsa-miR-4779	CLIP-seq
MIRT1374786	hsa-miR-4795-5p	CLIP-seq
MIRT1374787	hsa-miR-486-3p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374789	hsa-miR-510	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT1374791	hsa-miR-635	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT1374786	hsa-miR-4795-5p	CLIP-seq
MIRT1374787	hsa-miR-486-3p	CLIP-seq
MIRT2334629	hsa-miR-1197	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT2334634	hsa-miR-2467-3p	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT2334636	hsa-miR-4514	CLIP-seq
MIRT2334637	hsa-miR-4645-5p	CLIP-seq
MIRT2334638	hsa-miR-4673	CLIP-seq
MIRT2334639	hsa-miR-4692	CLIP-seq
MIRT1374761	hsa-miR-296-5p	CLIP-seq
MIRT1374765	hsa-miR-3614-5p	CLIP-seq
MIRT1374767	hsa-miR-4286	CLIP-seq
MIRT1374791	hsa-miR-635	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2460070	hsa-miR-1287	CLIP-seq
MIRT2460071	hsa-miR-2110	CLIP-seq
MIRT2460072	hsa-miR-3074-5p	CLIP-seq
MIRT2460073	hsa-miR-3135b	CLIP-seq
MIRT2460074	hsa-miR-3667-3p	CLIP-seq
MIRT2460075	hsa-miR-370	CLIP-seq
MIRT2460076	hsa-miR-4271	CLIP-seq
MIRT2460077	hsa-miR-4487	CLIP-seq
MIRT2460078	hsa-miR-4633-3p	CLIP-seq
MIRT2460079	hsa-miR-4667-5p	CLIP-seq
MIRT2460080	hsa-miR-4700-5p	CLIP-seq
MIRT2460081	hsa-miR-4725-3p	CLIP-seq
MIRT1374781	hsa-miR-4731-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT2628652	hsa-miR-1227	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2628653	hsa-miR-1294	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT2628654	hsa-miR-3130-3p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT2628655	hsa-miR-3184	CLIP-seq
MIRT2628656	hsa-miR-3650	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2628657	hsa-miR-3929	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2628658	hsa-miR-423-5p	CLIP-seq
MIRT2628659	hsa-miR-4261	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2628660	hsa-miR-4316	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2628661	hsa-miR-4419b	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2628662	hsa-miR-4455	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2628663	hsa-miR-4478	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2628664	hsa-miR-4651	CLIP-seq
MIRT2628665	hsa-miR-4695-5p	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2628666	hsa-miR-485-5p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2628667	hsa-miR-552	CLIP-seq
MIRT2628668	hsa-miR-608	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT2628669	hsa-miR-764	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2628652	hsa-miR-1227	CLIP-seq
MIRT1374756	hsa-miR-1228	CLIP-seq
MIRT2691545	hsa-miR-1254	CLIP-seq
MIRT2440590	hsa-miR-128	CLIP-seq
MIRT2440591	hsa-miR-1281	CLIP-seq
MIRT2440592	hsa-miR-1291	CLIP-seq
MIRT2628653	hsa-miR-1294	CLIP-seq
MIRT2334630	hsa-miR-1324	CLIP-seq
MIRT2691546	hsa-miR-137	CLIP-seq
MIRT2334631	hsa-miR-204	CLIP-seq
MIRT2440593	hsa-miR-2053	CLIP-seq
MIRT2334632	hsa-miR-211	CLIP-seq
MIRT2334633	hsa-miR-2114	CLIP-seq
MIRT1374760	hsa-miR-22	CLIP-seq
MIRT2691547	hsa-miR-25	CLIP-seq
MIRT2440594	hsa-miR-27a	CLIP-seq
MIRT2440595	hsa-miR-27b	CLIP-seq
MIRT2691548	hsa-miR-3116	CLIP-seq
MIRT2628654	hsa-miR-3130-3p	CLIP-seq
MIRT1374762	hsa-miR-3151	CLIP-seq
MIRT2111556	hsa-miR-3165	CLIP-seq
MIRT1374763	hsa-miR-3187-3p	CLIP-seq
MIRT2691549	hsa-miR-32	CLIP-seq
MIRT2691550	hsa-miR-346	CLIP-seq
MIRT2691551	hsa-miR-363	CLIP-seq
MIRT2628656	hsa-miR-3650	CLIP-seq
MIRT2691552	hsa-miR-367	CLIP-seq
MIRT2440596	hsa-miR-3680	CLIP-seq
MIRT2691553	hsa-miR-378g	CLIP-seq
MIRT2628657	hsa-miR-3929	CLIP-seq
MIRT2334635	hsa-miR-3942-3p	CLIP-seq
MIRT2628659	hsa-miR-4261	CLIP-seq
MIRT2440597	hsa-miR-4265	CLIP-seq
MIRT2440598	hsa-miR-4283	CLIP-seq
MIRT2440599	hsa-miR-4292	CLIP-seq
MIRT2440600	hsa-miR-4296	CLIP-seq
MIRT2628660	hsa-miR-4316	CLIP-seq
MIRT2440601	hsa-miR-4322	CLIP-seq
MIRT2691554	hsa-miR-4330	CLIP-seq
MIRT2628661	hsa-miR-4419b	CLIP-seq
MIRT2691555	hsa-miR-4437	CLIP-seq
MIRT2440602	hsa-miR-4447	CLIP-seq
MIRT2628662	hsa-miR-4455	CLIP-seq
MIRT1374770	hsa-miR-4459	CLIP-seq
MIRT2440603	hsa-miR-4472	CLIP-seq
MIRT2628663	hsa-miR-4478	CLIP-seq
MIRT2691556	hsa-miR-4481	CLIP-seq
MIRT2440604	hsa-miR-4489	CLIP-seq
MIRT2691557	hsa-miR-4494	CLIP-seq
MIRT2691558	hsa-miR-4508	CLIP-seq
MIRT1374776	hsa-miR-4529-5p	CLIP-seq
MIRT2628664	hsa-miR-4651	CLIP-seq
MIRT2691559	hsa-miR-4674	CLIP-seq
MIRT2628665	hsa-miR-4695-5p	CLIP-seq
MIRT2440605	hsa-miR-4715-3p	CLIP-seq
MIRT2691560	hsa-miR-4727-5p	CLIP-seq
MIRT2691561	hsa-miR-4745-5p	CLIP-seq
MIRT1374782	hsa-miR-4747-5p	CLIP-seq
MIRT2691562	hsa-miR-4769-3p	CLIP-seq
MIRT2440606	hsa-miR-4798-3p	CLIP-seq
MIRT2628666	hsa-miR-485-5p	CLIP-seq
MIRT2440607	hsa-miR-491-5p	CLIP-seq
MIRT2691563	hsa-miR-499a-5p	CLIP-seq
MIRT1374788	hsa-miR-502-5p	CLIP-seq
MIRT1374790	hsa-miR-544b	CLIP-seq
MIRT2628667	hsa-miR-552	CLIP-seq
MIRT2691564	hsa-miR-554	CLIP-seq
MIRT2628668	hsa-miR-608	CLIP-seq
MIRT1374792	hsa-miR-637	CLIP-seq
MIRT2691565	hsa-miR-661	CLIP-seq
MIRT2628669	hsa-miR-764	CLIP-seq
MIRT2440608	hsa-miR-885-5p	CLIP-seq
MIRT2691566	hsa-miR-92a	CLIP-seq
MIRT2691567	hsa-miR-92b	CLIP-seq

Show/Hide all (13)

Transcription factor	Regulation	Reference
CREB1	Repression	15955695
ESRRA	Repression	15955695
HMGA2	Unknown	22241470
HOXA10	Repression	16424022
ID2	Activation	22551584
MTA1	Activation	18719363
MTA3	Repression	23510993
NFKB1	Activation	17665043;18477483
NFKB1	Unknown	19538137
PARP1	Repression	21577210
RELA	Activation	17665043;18477483
RELA	Unknown	19538137
SNAI1	Unknown	16617148

Show/Hide all (77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11912130
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	15314165
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11912130
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11912130, 20562920
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	IEP	20128911
GO:0001650	Component	Fibrillar center	IDA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001707	Process	Mesoderm formation	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	16096638
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15448698, 16096638, 18331720, 19411070, 19955572, 20385133, 20389281, 20562920, 21577210, 23644467, 24209753, 25203322, 25314079, 25416956, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	15448698, 19955572, 23288509, 24209753, 25893292
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005721	Component	Pericentric heterochromatin	IDA	24239292
GO:0005721	Component	Pericentric heterochromatin	IEA
GO:0005737	Component	Cytoplasm	IDA	15448698, 19955572, 24209753
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	ISS
GO:0007219	Process	Notch signaling pathway	TAS	20951801
GO:0007498	Process	Mesoderm development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	20018240, 23288509
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	TAS	17072303
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IDA	19502595
GO:0010957	Process	Negative regulation of vitamin D biosynthetic process	IEA
GO:0019900	Function	Kinase binding	IPI	15448698
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	15314165, 20018240
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IMP	15314165
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20018240
GO:0046872	Function	Metal ion binding	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17072303
GO:0060536	Process	Cartilage morphogenesis	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060806	Process	Negative regulation of cell differentiation involved in embryonic placenta development	IEA
GO:0060972	Process	Left/right pattern formation	IEA
GO:0070828	Process	Heterochromatin organization	IEA
GO:0070828	Process	Heterochromatin organization	ISS
GO:0070888	Function	E-box binding	IDA	11912130
GO:0070888	Function	E-box binding	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IMP	15314165
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000810	Process	Regulation of bicellular tight junction assembly	IEA
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	15314165

MIM	HGNC	e!Ensembl
604238	11128	ENSG00000124216

O95863

Protein name

Zinc finger protein SNAI1 (Protein snail homolog 1) (Protein sna)

Protein function

Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration (PubMed:10655587, PubMed:15647282, PubMed:20389281, PubMed:20562920, PubMed:2195

PDB

2Y48 , 3W5K , 3ZMT , 4QLI , 8BOX , 8F59 , 8FDV , 8FJ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13912	zf-C2H2_6	153 → 177		Domain
PF00096	zf-C2H2	180 → 202	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	208 → 230	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. {ECO:0000269|PubMed:10655587}.

Sequence

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR

Sequence length

264

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, PAPILLARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (297)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
22q11 Deletion Syndrome	22q11 deletion syndrome	BEFREE	17097888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	18061568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30791220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25561901, 27191258, 29755680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	29464030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	28631560, 29424489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23029563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	28887601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26183460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	19018264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28887601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21181094, 21646478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	19018264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	21478114, 29844345		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22278018, 28032372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30368884		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26062664, 30791220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Argininosuccinic Aciduria	Argininosuccinic aciduria	Pubtator	23807225	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30816428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35008549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26654598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30816428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29104639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	28538179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	19695091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24424718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27322434, 28837140, 29032338, 30168179, 31221586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	21914172, 23157797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11850205, 24014025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11912130, 17072303, 18089802, 18588516, 19055748, 19597490, 19893985, 20109342, 20543867, 20935265, 22006115, 22307688, 23644467, 23762395, 24293287 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12082640, 15742334, 17761946, 18554584, 19055748, 19277896, 19844232, 20010940, 20109342, 20543867, 21110878, 21315410, 21324165, 21387303, 21914172 View all (52 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28607365, 30798422	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31681835, 31880901	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	20421926, 21206968, 22408413, 23430757, 24800235, 26015410, 28570699, 29065973, 33469676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11912130, 17374993, 19695091, 20043117, 24384091, 24642471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28534983, 31997506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28631560, 29424489, 29954240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	12082640, 19893985, 22012049, 25645984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	29937187	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	22012049, 24966944, 29937187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24800235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15026811, 15668718, 18691339, 20385133, 21494073, 21863061, 22511905, 23185371, 23496980, 26362312, 26516929, 26551737, 26655845, 27102441, 27134688 View all (30 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36374927	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21315410, 24966944, 30544617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	25413006	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	30798422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27322434, 28837140, 29032338, 30168179, 31221586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22024162, 24354880, 27554601, 28872461, 28883453, 29383119, 31106370, 31131753, 31243371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19695091, 27044634, 36149163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21288898, 23940742, 24903147, 26062664, 30791220, 31935687, 35327583, 38057853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17060462, 20372788, 21808237, 22363672, 23433103, 26261493, 28057716, 31658319, 31915310, 32458971, 36766694, 37569620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32124963	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25413006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20150431, 21834956, 28708785, 31886179, 32784485, 35763651, 36012449, 36638907, 39294686, 40515636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22344746, 26161782, 27044634, 30231243, 30272327, 31165775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	21808237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	35008549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	28442786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31205475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28708785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31205475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21181094, 21646478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24816558, 32020235, 36317517, 36972768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chordoma	Chordoma	Pubtator	29360338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	21617757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22621770, 24354880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	23663169, 28364893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	29374328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft palate and bilateral cleft lip	Cleft Palate And Bilateral Cleft Lip	BEFREE	31398065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31584460, 35484353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15322538, 15770204, 16203744, 16804902, 19502595, 19802011, 20138990, 20801642, 24242829, 27132510, 27277835, 27878251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15712635, 19107228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	15770204, 21890490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19440385, 30770873, 30818851, 31658326, 35217636, 36704936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19861116, 20813963, 21640118, 22569829, 23029563, 23522088, 24185900, 24402192, 25277775, 27836787, 29468299, 29475734, 29556313, 30025541, 30189360, 30528239, 31849492 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16024625, 19502595, 20026903, 20046424, 20138990, 20421926, 21811102, 23029563, 23431386, 23522088, 23996472, 25750173, 26015410, 26379394, 26632346 View all (33 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16203744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20138990, 29155818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25738332, 28759954	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30248044, 31383647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28057716, 28454361, 30772441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	10543399, 10585766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27322434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	27322434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29492209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28487991, 29532109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28487991, 29532109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26837280, 31361542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	39849873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	12082640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	16766568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	30343323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	29309923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	21478114, 28614716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26675296, 27171242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	34517088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19604315, 22640183, 23114646, 26367784, 26868332, 27171242, 27223076, 33457409, 36140779, 37169340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26198055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26198055, 35616875, 36232817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	35145202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	30679596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27044634, 30231243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16568079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29331416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27438288, 28132116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29331416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17273727, 27902974, 28035369, 32042337, 32323849, 34866524, 35595735, 37038094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Nonmedullary Thyroid Cancer	Thyroid cancer	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27661118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30013137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26120970, 29587268, 31336025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	37979250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	26302187, 31705138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	26302187, 31705138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	29294389	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22404757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32812461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	31553483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24999604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31553483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29492209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21225336, 24966907, 27705942, 28529599, 30260647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21225336, 23482671, 23776187, 23826359, 24966907, 26654598, 31037147, 34080022, 37594082, 37863960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33692132	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21225336, 24966907, 25838542, 27705942, 28529599, 30260647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24913705, 24959930, 32277674, 34269002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24959930, 25838542, 29845196, 30633952, 30655883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	35886848	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25838542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24191127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27956696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23149563, 29167122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	BEFREE	28364893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14507651, 19844232, 20010940, 22363487, 23002349, 23496980, 25168373, 26379394, 30781795, 36243933	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18427106, 24859886, 27012941, 27044634, 28764685, 32427827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19850962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24958208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	29074488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27113480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31423278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24966944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jeune syndrome	Jeune syndrome	Pubtator	35896673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29931517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28186539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	28057716, 37569620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30250575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30847305, 31055699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	28939076, 29970306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20385133, 21220499, 21480340, 22052196, 22911555, 22957763, 23474366, 23483190, 23496980, 23792447, 24626807, 24638979, 24954667, 25172662, 25574092 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36871637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33220464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22957763, 28734833, 31383647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25413006, 29719300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28803067, 30998937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35418483	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22753015, 23157169, 24253315, 25120788, 26722397, 26863455, 27015122, 28146373, 28296173, 28350337, 28678320, 28883453, 28925484, 29371906, 29979729 View all (10 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12082640, 20809941, 22471493, 23157797, 25120788, 25645984, 33817718, 35434126, 35651980, 38358184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17273727, 23151184, 23522088, 23874481, 23923074, 25964055, 26015410, 31774615, 35595735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31145904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	23928305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11850205, 24014025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11912130, 17072303, 18089802, 18588516, 19055748, 19597490, 19617568, 19893985, 20109342, 20543867, 20935265, 22006115, 22307688, 23644467, 23762395 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27171242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29331416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22404757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28057716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28734833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24354880, 27554601, 28872461, 28883453, 29383119, 31106370, 31131753, 31243371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22344746, 26161782, 30231243, 30272327, 31165775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20576520, 28145431, 29367759, 29601127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24424718, 24859886, 27566588, 30065348, 30161276, 31298493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16142376, 25832584, 26729198, 27461247, 28550287, 28918030, 29117943, 29858600, 30684287, 31081061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23432420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27322434, 28837140, 29032338, 30168179, 31221586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15983400, 17587826, 19124656, 19915148, 20385133, 21640118, 22024162, 22344746, 23432420, 23792447, 24859886, 25084828, 25164016, 25578726, 26339654 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31205475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15322538, 15770204, 16203744, 16804902, 19502595, 19802011, 20138990, 20801642, 24242829, 27132510, 27878251, 28759954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11850205, 24014025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11850205, 24014025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16169460, 18321996, 18554584, 19046938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25164016, 25990538, 29593211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11850205, 24014025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21181094, 21646478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11323412, 19208738, 20856146, 29385656, 29880840, 31171904, 39273022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12741683, 16034310, 19124656, 22131135, 28400282, 29385656, 31217934, 31340433		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17616667, 19124656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34769150	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27322434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25823924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30609805	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23149563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	34144151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18234959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18234959, 22349639, 29969465, 32928102, 39849873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24481661, 28008160, 30781795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29643704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	28615628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21386845, 22551584, 26497204, 31512056, 36354184, 37563232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28146149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16203744, 16568079, 16804902, 17724139, 18089802, 18408755, 19124656, 19188491, 19695091, 19802011, 19893985, 20043117, 20576520, 20813963, 21478114 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	35886848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29356585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	BEFREE	17587810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30013137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21633953, 23947765, 29355657, 30094882, 30261726, 30651886		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30936982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24966944, 28570750, 30544617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22355352	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35896673, 39738612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21963453, 26062797, 28032372, 28335789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27532429, 27706678, 28365963, 29048621, 30341688, 31173281, 33323539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31165775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31560827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18026186		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19695091, 22344746, 26161782, 30231243, 30272327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14507651, 18026186, 18550773, 18701475, 19695091, 20610539, 21559368, 22429801, 22479527, 25296567, 25326810, 25975373, 26161782, 26298390, 27129171 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32547317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20576520, 28145431, 29367759, 29601127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26062664, 29367759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21288898, 21709440, 22232555, 23940742, 24903147, 25409617, 30158928, 32090981, 33499904, 35300562, 35327583, 36333284, 38057853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21678462	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24276590, 29250189, 29427661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	26183460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	23831330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	25296567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26183460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	32190664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	15735690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28764685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20397042, 24424718, 24859886, 27566588, 30065348, 30161276, 31298493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17952120, 20385358, 20397042, 21478672, 22857708, 24481661, 24617993, 24859886, 25483191, 25552920, 26037169, 26207671, 26648419, 27409172, 27455254 View all (9 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30065348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29074408		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22621770, 28883453, 39969348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	24958208	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28872461, 30527805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33123215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	24384091, 28057716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24384091, 28057716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	17374993, 30332759, 30453174, 31361542, 31482255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	29371906	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29675549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	23077401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	21478114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	21478114, 32354171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	29104639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28755075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21983934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24947186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	21809991, 33076385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	32441446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	21439681, 26219900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	18408755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29074408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	31299087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30874360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23157169	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12632084, 18559496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18559498, 21647877, 29101499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28260072, 29059170, 29304493, 29331416, 29559747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21439681, 22201613, 22568942, 22580338, 23874481, 24045665, 25762643, 26214683, 28319306, 29138797, 29250652, 31861233, 32471980, 35434126, 35563463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27259998, 39849873	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27661118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16142376, 25832584, 26729198, 27461247, 28550287, 28918030, 29117943, 29858600, 30684287, 31081061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12414534, 16521229, 20332670, 22471493, 22471696, 22969242, 23151184, 24081672, 24115825, 24721928, 24815301, 24887009, 25055044, 25211665, 25547433 View all (29 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
synovial sarcoma	Synovial sarcoma	LHGDN	15467754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	20967026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	35575252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26219900, 27845909, 30832753, 33419089, 35651980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17724139, 23432420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25078145, 25755746, 35491899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23432420, 30368884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33333840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Total anomalous pulmonary venous return	Pulmonary Venous Return Anomaly	BEFREE	30448225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21315410, 28607365, 29729076, 30964885, 33428601, 34326372, 36171192, 39593161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29729076, 30488343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30488343	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	27939037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20809941, 24354468, 26844702, 27322434, 27906180, 28837140, 29250666, 29517839, 31221586, 34196584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30791220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	37175770	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23936413, 28212558, 28708785, 29899322, 31205475, 33098235, 36088372, 37175770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	26321866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	34944071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	20528783, 21853110, 39486365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome Type 2	Waardenburg Syndrome	BEFREE	15735690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	32571273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SNAI1 (snail family transcriptional repressor 1)