SMTNL1 (smoothelin like 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 219537
• Gene name: Smoothelin like 1
• Gene symbol: SMTNL1
• Synonyms (NCBI Gene): CHASM
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The protein encoded by this gene is involved in the contraction of both striated and smooth muscle. During pregnancy, the encoded protein interacts with progesterone receptor to attenuate the expression of contractile and metabolic proteins. [provided by

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017812	hsa-miR-335-5p	Microarray	18185580
MIRT1373974	hsa-miR-1285	CLIP-seq
MIRT1373975	hsa-miR-3160-3p	CLIP-seq
MIRT1373976	hsa-miR-3187-5p	CLIP-seq
MIRT1373977	hsa-miR-3620	CLIP-seq
MIRT1373978	hsa-miR-4487	CLIP-seq
MIRT1373979	hsa-miR-4663	CLIP-seq
MIRT1373980	hsa-miR-558	CLIP-seq
MIRT1373981	hsa-miR-604	CLIP-seq
MIRT1373982	hsa-miR-612	CLIP-seq
MIRT1373983	hsa-miR-647	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005516	Function	Calmodulin binding	IEA
GO:0005523	Function	Tropomyosin binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0008157	Function	Protein phosphatase 1 binding	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0014823	Process	Response to activity	IEA
GO:0030016	Component	Myofibril	IEA
GO:0031430	Component	M band	IEA
GO:0031674	Component	I band	IEA
GO:0042310	Process	Vasoconstriction	IEA
GO:0043292	Component	Contractile muscle fiber	IDA	20634291
GO:0043292	Component	Contractile muscle fiber	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0048644	Process	Muscle organ morphogenesis	IEA
GO:0051401	Function	CH domain binding	IEA
GO:0097718	Function	Disordered domain specific binding	IEA

Other IDs

• MIM: 613664
• HGNC: 32394
• e!Ensembl: ENSG00000214872

Protein

• UniProt ID: A8MU46
• Protein name: Smoothelin-like protein 1
• Protein function: Plays a role in the regulation of contractile properties of both striated and smooth muscles. When unphosphorylated, may inhibit myosin dephosphorylation. Phosphorylation at Ser-299 reduces this inhibitory activity (By similarity). {ECO:0000250}
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00307	CH	379 → 484	Calponin homology (CH) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in striated muscles, specifically in type 2a fibers (at protein level). {ECO:0000269|PubMed:18310078, ECO:0000269|PubMed:20634291}.
• Sequence:

  MEQKEGKLSEDGTTVSPAADNPEMSGGGAPAEETKGTAGKAINEGPPTESGKQEKAPAED
  GMSAELQGEANGLDEVKVESQREAGGKEDAEAELKKEDGEKEETTVGSQEMTGRKEETKS
  EPKEAEEKESTLASEKQKAEEKEAKPESGQKADANDRDKPEPKATVEEEDAKTASQEETG
  QRKECSTEPKEKATDEEAKAESQKAVVEDEAKAEPKEPDGKEEAKHGAKEEADAKEEAED
  AEEAEPGSPSEEQEQDVEKEPEGGAGVIPSSPEEWPESPTGEGHNLSTDGLGPDCVASGQ
  TSPSASESSPSDVPQSPPESPSSGEKKEKAPERRVSAPARPRGPRAQNRKAIVDKFGGAA
  SGPTALFRNTKAAGAAIGGVKNMLLEWCRAMTKKYEHVDIQNFSSSWSSGMAFCALIHKF
  FPDAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLDVDDMVRLAVPDSKCVYTYIQELY
  RSLVQKGLVKTKKK

• Sequence length: 494

Related Genes

No strongly related genes found yet for SMTNL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SMTNL1.