SMR3B (submaxillary gland androgen regulated protein 3B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10879
Gene name Submaxillary gland androgen regulated protein 3B
Gene symbol SMR3B
Synonyms (NCBI Gene)
P-BPBIIPRL3PROL3SMR1B
Chromosome 4
Chromosome location 4q13.3
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT054254 hsa-miR-495-3p qRT-PCRWestern blot 25475733
MIRT2111375 hsa-miR-1206 CLIP-seq
MIRT2111376 hsa-miR-370 CLIP-seq
MIRT2334464 hsa-miR-129-5p CLIP-seq
MIRT2334465 hsa-miR-3065-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004866 Function Endopeptidase inhibitor activity IBA
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space TAS 7982889
GO:0051930 Process Regulation of sensory perception of pain IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611593 17326 ENSG00000171201
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P02814
Protein name Submaxillary gland androgen-regulated protein 3B (Proline-rich peptide P-B) (Proline-rich protein 3) [Cleaved into: Peptide P-A; Peptide D1A]
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15621 PROL5-SMR 1 → 79 Proline-rich submaxillary gland androgen-regulated family Family
Tissue specificity TISSUE SPECIFICITY: Secreted into saliva by submaxillary gland. Not expressed in heart, brain, lung, liver, skeletal muscle, Kidney, pancreas or placenta. {ECO:0000269|PubMed:7982889}.
Sequence 
MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIP
PPPPAPYGPGIFPPPPPQP
Sequence length 79
Interactions View interactions

No strongly related genes found yet for SMR3B.

No additional diseases found yet through genes similar to SMR3B.