SMR3A (submaxillary gland androgen regulated protein 3A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 26952
Gene name Submaxillary gland androgen regulated protein 3A
Gene symbol SMR3A
Synonyms (NCBI Gene)
P-B1PBIPRL5PROL5
Chromosome 4
Chromosome location 4q13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004866 Function Endopeptidase inhibitor activity IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 9354371
GO:0051930 Process Regulation of sensory perception of pain IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618340 19216 ENSG00000109208
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99954
Protein name Submaxillary gland androgen-regulated protein 3A (Proline-rich protein 5) (Proline-rich protein PBI)
Protein function May play a role in protection or detoxification.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15621 PROL5-SMR 1 → 109 Proline-rich submaxillary gland androgen-regulated family Family
Sequence 
MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGP
GRFPPPLSPPYGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFP
VNSPTDPALPTPAP
Sequence length 134
Interactions View interactions

No strongly related genes found yet for SMR3A.

No additional diseases found yet through genes similar to SMR3A.