SMKR1 (small lysine rich protein 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100287482
Gene name Small lysine rich protein 1
Gene symbol SMKR1
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q32.1
miRNA miRNA information provided by mirtarbase database.
482 Show/Hide all (482)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT482907 hsa-miR-224-3p PAR-CLIP 20371350
MIRT482906 hsa-miR-522-3p PAR-CLIP 20371350
MIRT482904 hsa-miR-6758-5p PAR-CLIP 20371350
MIRT482905 hsa-miR-6856-5p PAR-CLIP 20371350
MIRT482903 hsa-miR-3125 PAR-CLIP 20371350
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H3BMG3
Protein name Small lysine-rich protein 1
Family and domains
Sequence 
MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGK
KGRSK
Sequence length 65
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ASTROCYTOMA — GWAS catalog 36810956
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Stomach Neoplasms Stomach neoplasms Pubtator 31959204 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for SMKR1.

No additional diseases found yet through genes similar to SMKR1.