SMIM9 (small integral membrane protein 9)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100132963
Gene name Small integral membrane protein 9
Gene symbol SMIM9
Synonyms (NCBI Gene)
CXorf68
Chromosome X
Chromosome location Xq28
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT560469 hsa-miR-7-5p PAR-CLIP 20371350
MIRT560467 hsa-miR-6077 PAR-CLIP 20371350
MIRT560468 hsa-miR-4775 PAR-CLIP 20371350
MIRT560466 hsa-miR-1297 PAR-CLIP 20371350
MIRT560465 hsa-miR-26a-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NGZ8
Protein name Small integral membrane protein 9
Family and domains
Sequence 
MEPQKLLIIGFLLCSLTCLLLETVASSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDY
LWQLIKSALPPAAIVAFLLTSALMGILCCFTILVVDPVH
Sequence length 99
Interactions View interactions

No strongly related genes found yet for SMIM9.

No additional diseases found yet through genes similar to SMIM9.