SMIM26 (small integral membrane protein 26)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 388789
Gene name Small integral membrane protein 26
Gene symbol SMIM26
Synonyms (NCBI Gene)
LINC00493
Chromosome 20
Chromosome location 20p11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 37009826
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 33386847
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IDA 37009826
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A096LP01
Protein name Small integral membrane protein 26
Protein function May play a role in cell viability.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in kidney (at protein level). {ECO:0000269|PubMed:37009826}.
Sequence 
MYRNEFTAWYRRMSVVYGIGTWSVLGSLLYYSRTMAKSSVDQKDGSASEVPSELSERPKG
FYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
Sequence length 95
Interactions View interactions

No strongly related genes found yet for SMIM26.

No additional diseases found yet through genes similar to SMIM26.