SMIM22 (small integral membrane protein 22)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440335
Gene name Small integral membrane protein 22
Gene symbol SMIM22
Synonyms (NCBI Gene)
CASIMO1
Chromosome 16
Chromosome location 16p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 29765154
GO:0005768 Component Endosome IEA
GO:0005770 Component Late endosome IEA
GO:0016020 Component Membrane IEA
GO:0030335 Process Positive regulation of cell migration IMP 29765154
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
K7EJ46
Protein name Small integral membrane protein 22 (Cancer-associated small integral membrane open reading frame 1)
Protein function May modulate lipid droplet formation throught interaction with SQLE.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15831 DUF4713 6 → 60 Domain of unknown function (DUF4713) Family
Sequence 
MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSS
PGPRRESPRKERPKGVDNLALEP
Sequence length 83
Interactions View interactions

No strongly related genes found yet for SMIM22.

No additional diseases found yet through genes similar to SMIM22.