SMIM18 (small integral membrane protein 18)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100507341
Gene name Small integral membrane protein 18
Gene symbol SMIM18
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p12
miRNA miRNA information provided by mirtarbase database.
20 Show/Hide all (20)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT653336 hsa-miR-28-3p HITS-CLIP 23824327
MIRT653335 hsa-miR-5680 HITS-CLIP 23824327
MIRT653334 hsa-miR-3127-3p HITS-CLIP 23824327
MIRT653333 hsa-miR-6756-3p HITS-CLIP 23824327
MIRT653332 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DKX4
Protein name Small integral membrane protein 18
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15831 DUF4713 8 → 64 Domain of unknown function (DUF4713) Family
Sequence 
MASSHWNETTTSVYQYLGFQVQKIYPFHDNWNTACFVILLLFIFTVVSLVVLAFLYEVLD
CCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV
Sequence length 95
Interactions View interactions

No strongly related genes found yet for SMIM18.

No additional diseases found yet through genes similar to SMIM18.