SMCR5 (Smith-Magenis syndrome chromosome region, candidate 5)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 140771 |
| Gene name | Smith-Magenis syndrome chromosome region, candidate 5 |
| Gene symbol | SMCR5 |
| Synonyms (NCBI Gene) |
NCRNA00034
|
| Chromosome | 17 |
| Chromosome location | - |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8TEV8 |
| Protein name | Smith-Magenis syndrome chromosomal region candidate gene 5 protein |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11997338}. |
| Sequence |
MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPP |
| Sequence length | 140 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SMCR5 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SMCR5 (see Related Genes above), that are NOT already directly curated for SMCR5 itself -- a lead worth checking, not a confirmed association.
0
|
|