SMAD5-AS1 (SMAD5 antisense RNA 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9597
Gene name SMAD5 antisense RNA 1
Gene symbol SMAD5-AS1
Synonyms (NCBI Gene)
DAMSSMAD5ASSMAD5OS
Chromosome 5
Chromosome location 5q31.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000512 Process LncRNA-mediated post-transcriptional gene silencing IDA 31921616
GO:0007165 Process Signal transduction TAS 10049768
GO:0030513 Process Positive regulation of BMP signaling pathway IMP 31921616
GO:0140869 Function MiRNA inhibitor activity via base-pairing IDA 31921616
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620035 30586 ENSG00000164621
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y6J3
Protein name SMAD5 antisense gene protein 1 (10.3 kDa proline-rich protein DAMS) (SMAD5 antisense RNA 1) (SMAD5 opposite strand protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal tissues.
Sequence 
MHKQPKLLPPPATPPPPPQSSSWSGNIVFTIKINIWLRVFSHSSPTGLPKPHSPMPSPPE
PEHSVGKPANVQIPQVSSPEFCNQKSVLATEHAQT
Sequence length 95
Interactions View interactions

No strongly related genes found yet for SMAD5-AS1.

No additional diseases found yet through genes similar to SMAD5-AS1.