SLURP2 (secreted LY6/PLAUR domain containing 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 432355
Gene name Secreted LY6/PLAUR domain containing 2
Gene symbol SLURP2
Synonyms (NCBI Gene)
SLURP-2
Chromosome 8
Chromosome location 8q24.3
Summary This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic ski
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IDA 16575903
GO:0005886 Component Plasma membrane IBA
GO:0030548 Function Acetylcholine receptor regulator activity IDA 27485575
GO:0030550 Function Acetylcholine receptor inhibitor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DP57
Protein name Secreted Ly-6/uPAR domain-containing protein 2 (Secreted LY6/PLAUR domain-containing protein 2) (Secreted Ly-6/uPAR-related protein 2) (SLURP-2)
Protein function Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-con
PDB 2N99
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 25 → 95 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. Up-re
Sequence 
MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTED
LPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Sequence length 97
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Neuroactive ligand-receptor interaction

No strongly related genes found yet for SLURP2.

No additional diseases found yet through genes similar to SLURP2.