SLF1 (SMC5/6 complex localization factor 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 84250
• Gene name: SMC5/6 complex localization factor 1
• Gene symbol: SLF1
• Synonyms (NCBI Gene): ANKRD32, BRCTD1, BRCTx, hNSE5
• Chromosome: 5
• Chromosome location: 5q15

miRNA Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT630627	hsa-miR-4434	HITS-CLIP	19536157
MIRT630626	hsa-miR-4516	HITS-CLIP	19536157
MIRT630625	hsa-miR-5703	HITS-CLIP	19536157
MIRT714876	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT630624	hsa-miR-4531	HITS-CLIP	19536157
MIRT630627	hsa-miR-4434	HITS-CLIP	19536157
MIRT630626	hsa-miR-4516	HITS-CLIP	19536157
MIRT630625	hsa-miR-5703	HITS-CLIP	19536157
MIRT714876	hsa-miR-516b-5p	HITS-CLIP	19536157
MIRT630624	hsa-miR-4531	HITS-CLIP	19536157
MIRT630627	hsa-miR-4434	HITS-CLIP	19536157
MIRT630626	hsa-miR-4516	HITS-CLIP	19536157
MIRT630625	hsa-miR-5703	HITS-CLIP	19536157
MIRT630624	hsa-miR-4531	HITS-CLIP	19536157
MIRT630627	hsa-miR-4434	HITS-CLIP	23824327
MIRT630626	hsa-miR-4516	HITS-CLIP	23824327
MIRT630625	hsa-miR-5703	HITS-CLIP	23824327
MIRT630624	hsa-miR-4531	HITS-CLIP	23824327
MIRT630627	hsa-miR-4434	HITS-CLIP	23824327
MIRT630626	hsa-miR-4516	HITS-CLIP	23824327
MIRT630625	hsa-miR-5703	HITS-CLIP	23824327
MIRT630624	hsa-miR-4531	HITS-CLIP	23824327
MIRT630627	hsa-miR-4434	HITS-CLIP	23824327
MIRT630626	hsa-miR-4516	HITS-CLIP	23824327
MIRT630625	hsa-miR-5703	HITS-CLIP	23824327
MIRT630624	hsa-miR-4531	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	NAS	16810316
GO:0000781	Component	Chromosome, telomeric region	NAS	17589526
GO:0000786	Component	Nucleosome	IEA
GO:0000786	Component	Nucleosome	ISS
GO:0005515	Function	Protein binding	IPI	25931565, 26496610, 32389690, 33961781, 36373674
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	25931565
GO:0006974	Process	DNA damage response	IEA
GO:0016925	Process	Protein sumoylation	NAS	32389690
GO:0030915	Component	Smc5-Smc6 complex	NAS	32389690
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	25931565
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25931565
GO:0032204	Process	Regulation of telomere maintenance	NAS	17589526
GO:0034184	Process	Positive regulation of maintenance of mitotic sister chromatid cohesion	IMP	25931565
GO:0035861	Component	Site of double-strand break	IBA
GO:0035861	Component	Site of double-strand break	IDA	25931565
GO:0042405	Component	Nuclear inclusion body	IEA
GO:0042405	Component	Nuclear inclusion body	ISS
GO:0044877	Function	Protein-containing complex binding	IPI	25931565
GO:0140588	Process	Chromatin looping	NAS	32389690
GO:1990166	Process	Protein localization to site of double-strand break	IBA
GO:1990166	Process	Protein localization to site of double-strand break	IDA	25931565
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	25931565
GO:2000781	Process	Positive regulation of double-strand break repair	IEA

Other IDs

• MIM: 618467
• HGNC: 25408
• e!Ensembl: ENSG00000133302

Protein

• UniProt ID: Q9BQI6
• Protein name: SMC5-SMC6 complex localization factor protein 1 (Ankyrin repeat domain-containing protein 32) (BRCT domain-containing protein 1) (Smc5/6 localization factor 1)
• Protein function: Plays a role in the DNA damage response (DDR) pathway by regulating postreplication repair of UV-damaged DNA and genomic stability maintenance (PubMed:25931565). The SLF1-SLF2 complex acts to link RAD18 with the SMC5-SMC6 complex at replication-
• PDB: 8IR2 , 8IR4 , 8PEF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	811 → 907	Ankyrin repeats (3 copies)	Repeat
  PF16770	RTT107_BRCT_5	4 → 90	Regulator of Ty1 transposition protein 107 BRCT domain	Domain

• Sequence:

  MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
  CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA
  PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD
  NFKAPFYPIQYLGDFLLEKEIQNDEDSQTNSVWTEHSNEETNKDFRKDAGFLEMKGALRE
  TMYRTQKEMQNHEDVNVGSILIQHHKKEKFSGSSKDLKFVKMRNTFGSHTYENQKEIKKK
  DEDIQRSYTLRRKRKKGKESNCKKGVEHEKIKSTLRRHIYNRDQKEMKNSIFAEYAKESK
  AMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESL
  IEGHFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDNIDTFSGRYFHILSALLHLHPPW
  KSPAMSRYYLELFQCPTCMKGAWSLVEVLIRSCLFNESFCHQISENIGSKVLHLTLLKFF
  FNLIESEVQHLSQKLYDWSDSQNLKITGKAMLLEIFWSGSETSGLLTKPVNMLLEWTIYS
  HKEKFKSNDVFKHELAYLLAGILGAAIDYWIFLGLKMGRNVMRHMSDDLGSYVSLSCDDF
  SSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGV
  LGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKS
  EGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNA
  GWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGP
  VLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLS
  RMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQK
  LPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS

• Sequence length: 1058

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28741714		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SLF1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLF1.