SLC9A1 (solute carrier family 9 member A1)

Gene

• Entrez ID: 6548
• Gene name: Solute carrier family 9 member A1
• Gene symbol: SLC9A1
• Synonyms (NCBI Gene): APNH, LIKNS, NHE-1, NHE1, PPP1R143
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: This gene encodes a Na+/H+ antiporter that is a member of the solute carrier family 9. The encoded protein is a plasma membrane transporter that is expressed in the kidney and intestine. This protein plays a central role in regulating pH homeostasis, cell

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs786204831	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1553175089	T>G	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023332	hsa-miR-122-5p	Microarray	17612493
MIRT044326	hsa-miR-106b-5p	CLASH	23622248
MIRT043512	hsa-miR-331-3p	CLASH	23622248
MIRT484494	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT484493	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT484492	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT484491	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT484490	hsa-miR-4533	PAR-CLIP	23592263
MIRT023332	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT484489	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT484488	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT484487	hsa-miR-4271	PAR-CLIP	23592263
MIRT484485	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT484486	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT484484	hsa-miR-4417	PAR-CLIP	23592263
MIRT484483	hsa-miR-3911	PAR-CLIP	23592263
MIRT484482	hsa-miR-644a	PAR-CLIP	23592263
MIRT484481	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT484480	hsa-miR-4265	PAR-CLIP	23592263
MIRT484479	hsa-miR-4296	PAR-CLIP	23592263
MIRT484478	hsa-miR-4322	PAR-CLIP	23592263
MIRT484477	hsa-miR-147a	PAR-CLIP	23592263
MIRT726507	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726505	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726506	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726504	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT066935	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT066936	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT726503	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726502	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726501	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT484494	hsa-miR-4433b-3p	PAR-CLIP	23592263
MIRT484493	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT484492	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT484491	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT484490	hsa-miR-4533	PAR-CLIP	23592263
MIRT023332	hsa-miR-122-5p	PAR-CLIP	23592263
MIRT484489	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT484488	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT484487	hsa-miR-4271	PAR-CLIP	23592263
MIRT484485	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT484486	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT484484	hsa-miR-4417	PAR-CLIP	23592263
MIRT484483	hsa-miR-3911	PAR-CLIP	23592263
MIRT484482	hsa-miR-644a	PAR-CLIP	23592263
MIRT484481	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT484480	hsa-miR-4265	PAR-CLIP	23592263
MIRT484479	hsa-miR-4296	PAR-CLIP	23592263
MIRT484478	hsa-miR-4322	PAR-CLIP	23592263
MIRT484477	hsa-miR-147a	PAR-CLIP	23592263
MIRT1368491	hsa-miR-1207-5p	CLIP-seq
MIRT1368492	hsa-miR-122	CLIP-seq
MIRT1368493	hsa-miR-1245b-5p	CLIP-seq
MIRT1368494	hsa-miR-1263	CLIP-seq
MIRT1368495	hsa-miR-1273g	CLIP-seq
MIRT1368496	hsa-miR-1275	CLIP-seq
MIRT1368497	hsa-miR-1280	CLIP-seq
MIRT1368498	hsa-miR-1281	CLIP-seq
MIRT1368499	hsa-miR-1286	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT1368501	hsa-miR-1324	CLIP-seq
MIRT1368502	hsa-miR-1343	CLIP-seq
MIRT1368503	hsa-miR-1827	CLIP-seq
MIRT1368504	hsa-miR-1915	CLIP-seq
MIRT1368505	hsa-miR-1972	CLIP-seq
MIRT1368506	hsa-miR-214	CLIP-seq
MIRT1368507	hsa-miR-2278	CLIP-seq
MIRT1368508	hsa-miR-25	CLIP-seq
MIRT1368509	hsa-miR-3136-3p	CLIP-seq
MIRT1368510	hsa-miR-3142	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT1368512	hsa-miR-3153	CLIP-seq
MIRT1368513	hsa-miR-3169	CLIP-seq
MIRT1368514	hsa-miR-3182	CLIP-seq
MIRT1368515	hsa-miR-3189-5p	CLIP-seq
MIRT1368516	hsa-miR-32	CLIP-seq
MIRT1368517	hsa-miR-323b-5p	CLIP-seq
MIRT1368518	hsa-miR-335	CLIP-seq
MIRT1368519	hsa-miR-345	CLIP-seq
MIRT1368520	hsa-miR-3619-5p	CLIP-seq
MIRT1368521	hsa-miR-3620	CLIP-seq
MIRT1368522	hsa-miR-363	CLIP-seq
MIRT1368523	hsa-miR-367	CLIP-seq
MIRT1368524	hsa-miR-3686	CLIP-seq
MIRT1368525	hsa-miR-3689d	CLIP-seq
MIRT1368526	hsa-miR-371b-3p	CLIP-seq
MIRT1368527	hsa-miR-3926	CLIP-seq
MIRT1368528	hsa-miR-4269	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT1368530	hsa-miR-4328	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT1368532	hsa-miR-4437	CLIP-seq
MIRT1368533	hsa-miR-4438	CLIP-seq
MIRT1368534	hsa-miR-4447	CLIP-seq
MIRT1368535	hsa-miR-4455	CLIP-seq
MIRT1368536	hsa-miR-4457	CLIP-seq
MIRT1368537	hsa-miR-4459	CLIP-seq
MIRT1368538	hsa-miR-4472	CLIP-seq
MIRT1368539	hsa-miR-4475	CLIP-seq
MIRT1368540	hsa-miR-4487	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368542	hsa-miR-4514	CLIP-seq
MIRT1368543	hsa-miR-4515	CLIP-seq
MIRT1368544	hsa-miR-4520a-3p	CLIP-seq
MIRT1368545	hsa-miR-4520b-3p	CLIP-seq
MIRT1368546	hsa-miR-4525	CLIP-seq
MIRT1368547	hsa-miR-4530	CLIP-seq
MIRT1368548	hsa-miR-4536	CLIP-seq
MIRT1368549	hsa-miR-4650-5p	CLIP-seq
MIRT1368550	hsa-miR-4653-3p	CLIP-seq
MIRT1368551	hsa-miR-4659a-3p	CLIP-seq
MIRT1368552	hsa-miR-4659b-3p	CLIP-seq
MIRT1368553	hsa-miR-4665-5p	CLIP-seq
MIRT1368554	hsa-miR-4674	CLIP-seq
MIRT1368555	hsa-miR-4685-5p	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT1368557	hsa-miR-4690-5p	CLIP-seq
MIRT1368558	hsa-miR-4692	CLIP-seq
MIRT1368559	hsa-miR-4709-5p	CLIP-seq
MIRT1368560	hsa-miR-4713-5p	CLIP-seq
MIRT1368561	hsa-miR-4714-5p	CLIP-seq
MIRT1368562	hsa-miR-4722-5p	CLIP-seq
MIRT1368563	hsa-miR-4723-5p	CLIP-seq
MIRT1368564	hsa-miR-4728-5p	CLIP-seq
MIRT1368565	hsa-miR-4736	CLIP-seq
MIRT1368566	hsa-miR-4746-3p	CLIP-seq
MIRT1368567	hsa-miR-4758-3p	CLIP-seq
MIRT1368568	hsa-miR-4763-3p	CLIP-seq
MIRT1368569	hsa-miR-4779	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT1368571	hsa-miR-4786-5p	CLIP-seq
MIRT1368572	hsa-miR-5095	CLIP-seq
MIRT1368573	hsa-miR-625	CLIP-seq
MIRT1368574	hsa-miR-637	CLIP-seq
MIRT1368575	hsa-miR-646	CLIP-seq
MIRT1368576	hsa-miR-759	CLIP-seq
MIRT1368577	hsa-miR-761	CLIP-seq
MIRT1368578	hsa-miR-765	CLIP-seq
MIRT1368579	hsa-miR-769-5p	CLIP-seq
MIRT1368580	hsa-miR-877	CLIP-seq
MIRT1368581	hsa-miR-885-3p	CLIP-seq
MIRT1368582	hsa-miR-922	CLIP-seq
MIRT1368583	hsa-miR-92a	CLIP-seq
MIRT1368584	hsa-miR-92b	CLIP-seq
MIRT1368585	hsa-miR-940	CLIP-seq
MIRT1368542	hsa-miR-4514	CLIP-seq
MIRT1368558	hsa-miR-4692	CLIP-seq
MIRT2109521	hsa-miR-1208	CLIP-seq
MIRT1368492	hsa-miR-122	CLIP-seq
MIRT2109522	hsa-miR-1245b-3p	CLIP-seq
MIRT1368496	hsa-miR-1275	CLIP-seq
MIRT1368499	hsa-miR-1286	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT2109523	hsa-miR-1299	CLIP-seq
MIRT1368501	hsa-miR-1324	CLIP-seq
MIRT1368502	hsa-miR-1343	CLIP-seq
MIRT2109524	hsa-miR-140-3p	CLIP-seq
MIRT1368503	hsa-miR-1827	CLIP-seq
MIRT2109525	hsa-miR-185	CLIP-seq
MIRT1368504	hsa-miR-1915	CLIP-seq
MIRT1368505	hsa-miR-1972	CLIP-seq
MIRT2109526	hsa-miR-1976	CLIP-seq
MIRT1368506	hsa-miR-214	CLIP-seq
MIRT2109527	hsa-miR-2392	CLIP-seq
MIRT2109528	hsa-miR-2467-5p	CLIP-seq
MIRT1368508	hsa-miR-25	CLIP-seq
MIRT2109529	hsa-miR-2682	CLIP-seq
MIRT2109530	hsa-miR-2964a-5p	CLIP-seq
MIRT2109531	hsa-miR-3135b	CLIP-seq
MIRT1368509	hsa-miR-3136-3p	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT1368513	hsa-miR-3169	CLIP-seq
MIRT1368514	hsa-miR-3182	CLIP-seq
MIRT2109532	hsa-miR-3188	CLIP-seq
MIRT1368515	hsa-miR-3189-5p	CLIP-seq
MIRT1368516	hsa-miR-32	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT1368518	hsa-miR-335	CLIP-seq
MIRT2109534	hsa-miR-338-3p	CLIP-seq
MIRT2109535	hsa-miR-3605-5p	CLIP-seq
MIRT1368520	hsa-miR-3619-5p	CLIP-seq
MIRT1368522	hsa-miR-363	CLIP-seq
MIRT2109536	hsa-miR-3652	CLIP-seq
MIRT2109537	hsa-miR-3665	CLIP-seq
MIRT1368523	hsa-miR-367	CLIP-seq
MIRT2109538	hsa-miR-3682-5p	CLIP-seq
MIRT1368524	hsa-miR-3686	CLIP-seq
MIRT1368525	hsa-miR-3689d	CLIP-seq
MIRT1368526	hsa-miR-371b-3p	CLIP-seq
MIRT2109539	hsa-miR-3915	CLIP-seq
MIRT2109540	hsa-miR-3919	CLIP-seq
MIRT2109541	hsa-miR-3921	CLIP-seq
MIRT2109542	hsa-miR-3928	CLIP-seq
MIRT2109543	hsa-miR-3975	CLIP-seq
MIRT2109544	hsa-miR-4266	CLIP-seq
MIRT1368528	hsa-miR-4269	CLIP-seq
MIRT2109545	hsa-miR-4290	CLIP-seq
MIRT2109546	hsa-miR-4306	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT1368530	hsa-miR-4328	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT2109547	hsa-miR-4430	CLIP-seq
MIRT1368533	hsa-miR-4438	CLIP-seq
MIRT1368534	hsa-miR-4447	CLIP-seq
MIRT1368538	hsa-miR-4472	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT2109549	hsa-miR-4481	CLIP-seq
MIRT2109550	hsa-miR-449c	CLIP-seq
MIRT2109551	hsa-miR-4502	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368542	hsa-miR-4514	CLIP-seq
MIRT1368543	hsa-miR-4515	CLIP-seq
MIRT1368544	hsa-miR-4520a-3p	CLIP-seq
MIRT1368545	hsa-miR-4520b-3p	CLIP-seq
MIRT1368546	hsa-miR-4525	CLIP-seq
MIRT1368547	hsa-miR-4530	CLIP-seq
MIRT2109552	hsa-miR-4644	CLIP-seq
MIRT2109553	hsa-miR-4645-5p	CLIP-seq
MIRT1368549	hsa-miR-4650-5p	CLIP-seq
MIRT1368550	hsa-miR-4653-3p	CLIP-seq
MIRT2109554	hsa-miR-4653-5p	CLIP-seq
MIRT1368551	hsa-miR-4659a-3p	CLIP-seq
MIRT1368552	hsa-miR-4659b-3p	CLIP-seq
MIRT2109555	hsa-miR-4660	CLIP-seq
MIRT2109556	hsa-miR-4663	CLIP-seq
MIRT1368553	hsa-miR-4665-5p	CLIP-seq
MIRT2109557	hsa-miR-4673	CLIP-seq
MIRT2109558	hsa-miR-4677-3p	CLIP-seq
MIRT2109559	hsa-miR-4679	CLIP-seq
MIRT2109560	hsa-miR-4682	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT2109561	hsa-miR-4690-3p	CLIP-seq
MIRT1368557	hsa-miR-4690-5p	CLIP-seq
MIRT1368558	hsa-miR-4692	CLIP-seq
MIRT2109562	hsa-miR-4694-3p	CLIP-seq
MIRT2109563	hsa-miR-4708-5p	CLIP-seq
MIRT1368559	hsa-miR-4709-5p	CLIP-seq
MIRT2109564	hsa-miR-4722-3p	CLIP-seq
MIRT1368563	hsa-miR-4723-5p	CLIP-seq
MIRT1368564	hsa-miR-4728-5p	CLIP-seq
MIRT1368565	hsa-miR-4736	CLIP-seq
MIRT2109565	hsa-miR-4745-5p	CLIP-seq
MIRT2109566	hsa-miR-4756-3p	CLIP-seq
MIRT1368567	hsa-miR-4758-3p	CLIP-seq
MIRT2109567	hsa-miR-4762-3p	CLIP-seq
MIRT1368569	hsa-miR-4779	CLIP-seq
MIRT2109568	hsa-miR-4782-5p	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT2109569	hsa-miR-485-5p	CLIP-seq
MIRT1368572	hsa-miR-5095	CLIP-seq
MIRT2109570	hsa-miR-516b	CLIP-seq
MIRT1368573	hsa-miR-625	CLIP-seq
MIRT1368574	hsa-miR-637	CLIP-seq
MIRT1368576	hsa-miR-759	CLIP-seq
MIRT1368577	hsa-miR-761	CLIP-seq
MIRT2109571	hsa-miR-764	CLIP-seq
MIRT1368580	hsa-miR-877	CLIP-seq
MIRT1368582	hsa-miR-922	CLIP-seq
MIRT1368583	hsa-miR-92a	CLIP-seq
MIRT1368584	hsa-miR-92b	CLIP-seq
MIRT1368585	hsa-miR-940	CLIP-seq
MIRT1368491	hsa-miR-1207-5p	CLIP-seq
MIRT2109521	hsa-miR-1208	CLIP-seq
MIRT1368492	hsa-miR-122	CLIP-seq
MIRT2109522	hsa-miR-1245b-3p	CLIP-seq
MIRT1368493	hsa-miR-1245b-5p	CLIP-seq
MIRT2332656	hsa-miR-1262	CLIP-seq
MIRT1368494	hsa-miR-1263	CLIP-seq
MIRT2332657	hsa-miR-1266	CLIP-seq
MIRT1368495	hsa-miR-1273g	CLIP-seq
MIRT1368496	hsa-miR-1275	CLIP-seq
MIRT1368497	hsa-miR-1280	CLIP-seq
MIRT1368498	hsa-miR-1281	CLIP-seq
MIRT1368499	hsa-miR-1286	CLIP-seq
MIRT2332658	hsa-miR-1293	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT2109523	hsa-miR-1299	CLIP-seq
MIRT1368501	hsa-miR-1324	CLIP-seq
MIRT1368502	hsa-miR-1343	CLIP-seq
MIRT2332659	hsa-miR-1470	CLIP-seq
MIRT1368503	hsa-miR-1827	CLIP-seq
MIRT2109525	hsa-miR-185	CLIP-seq
MIRT1368504	hsa-miR-1915	CLIP-seq
MIRT1368505	hsa-miR-1972	CLIP-seq
MIRT2109526	hsa-miR-1976	CLIP-seq
MIRT2332660	hsa-miR-19a	CLIP-seq
MIRT2332661	hsa-miR-19b	CLIP-seq
MIRT1368506	hsa-miR-214	CLIP-seq
MIRT1368507	hsa-miR-2278	CLIP-seq
MIRT2109527	hsa-miR-2392	CLIP-seq
MIRT1368508	hsa-miR-25	CLIP-seq
MIRT2332662	hsa-miR-296-5p	CLIP-seq
MIRT2332663	hsa-miR-3131	CLIP-seq
MIRT1368510	hsa-miR-3142	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT1368512	hsa-miR-3153	CLIP-seq
MIRT2332664	hsa-miR-3157-5p	CLIP-seq
MIRT1368513	hsa-miR-3169	CLIP-seq
MIRT1368514	hsa-miR-3182	CLIP-seq
MIRT1368516	hsa-miR-32	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT1368517	hsa-miR-323b-5p	CLIP-seq
MIRT2332665	hsa-miR-329	CLIP-seq
MIRT2332666	hsa-miR-342-5p	CLIP-seq
MIRT1368519	hsa-miR-345	CLIP-seq
MIRT2109535	hsa-miR-3605-5p	CLIP-seq
MIRT2332667	hsa-miR-361-3p	CLIP-seq
MIRT1368520	hsa-miR-3619-5p	CLIP-seq
MIRT1368521	hsa-miR-3620	CLIP-seq
MIRT2332668	hsa-miR-362-3p	CLIP-seq
MIRT1368522	hsa-miR-363	CLIP-seq
MIRT1368523	hsa-miR-367	CLIP-seq
MIRT1368524	hsa-miR-3686	CLIP-seq
MIRT2109539	hsa-miR-3915	CLIP-seq
MIRT1368527	hsa-miR-3926	CLIP-seq
MIRT2109542	hsa-miR-3928	CLIP-seq
MIRT2332669	hsa-miR-3941	CLIP-seq
MIRT1368528	hsa-miR-4269	CLIP-seq
MIRT2332670	hsa-miR-4274	CLIP-seq
MIRT2332671	hsa-miR-4278	CLIP-seq
MIRT2332672	hsa-miR-4291	CLIP-seq
MIRT2109546	hsa-miR-4306	CLIP-seq
MIRT2332673	hsa-miR-4307	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT1368530	hsa-miR-4328	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT2332674	hsa-miR-4435	CLIP-seq
MIRT1368532	hsa-miR-4437	CLIP-seq
MIRT1368533	hsa-miR-4438	CLIP-seq
MIRT1368534	hsa-miR-4447	CLIP-seq
MIRT1368535	hsa-miR-4455	CLIP-seq
MIRT1368536	hsa-miR-4457	CLIP-seq
MIRT1368537	hsa-miR-4459	CLIP-seq
MIRT1368538	hsa-miR-4472	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT2332675	hsa-miR-4483	CLIP-seq
MIRT1368540	hsa-miR-4487	CLIP-seq
MIRT2332676	hsa-miR-4488	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368542	hsa-miR-4514	CLIP-seq
MIRT2332677	hsa-miR-4518	CLIP-seq
MIRT1368544	hsa-miR-4520a-3p	CLIP-seq
MIRT1368545	hsa-miR-4520b-3p	CLIP-seq
MIRT1368546	hsa-miR-4525	CLIP-seq
MIRT1368547	hsa-miR-4530	CLIP-seq
MIRT1368548	hsa-miR-4536	CLIP-seq
MIRT2332678	hsa-miR-455-5p	CLIP-seq
MIRT2109552	hsa-miR-4644	CLIP-seq
MIRT2332679	hsa-miR-4651	CLIP-seq
MIRT1368550	hsa-miR-4653-3p	CLIP-seq
MIRT1368551	hsa-miR-4659a-3p	CLIP-seq
MIRT1368552	hsa-miR-4659b-3p	CLIP-seq
MIRT2332680	hsa-miR-4664-5p	CLIP-seq
MIRT1368553	hsa-miR-4665-5p	CLIP-seq
MIRT2332681	hsa-miR-4667-3p	CLIP-seq
MIRT1368554	hsa-miR-4674	CLIP-seq
MIRT2332682	hsa-miR-4675	CLIP-seq
MIRT1368555	hsa-miR-4685-5p	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT1368557	hsa-miR-4690-5p	CLIP-seq
MIRT2332683	hsa-miR-4691-3p	CLIP-seq
MIRT1368558	hsa-miR-4692	CLIP-seq
MIRT2332684	hsa-miR-4697-5p	CLIP-seq
MIRT2332685	hsa-miR-4701-3p	CLIP-seq
MIRT1368559	hsa-miR-4709-5p	CLIP-seq
MIRT1368560	hsa-miR-4713-5p	CLIP-seq
MIRT1368561	hsa-miR-4714-5p	CLIP-seq
MIRT2332686	hsa-miR-4716-3p	CLIP-seq
MIRT2109564	hsa-miR-4722-3p	CLIP-seq
MIRT1368562	hsa-miR-4722-5p	CLIP-seq
MIRT1368563	hsa-miR-4723-5p	CLIP-seq
MIRT1368564	hsa-miR-4728-5p	CLIP-seq
MIRT2332687	hsa-miR-4731-3p	CLIP-seq
MIRT2332688	hsa-miR-4731-5p	CLIP-seq
MIRT1368565	hsa-miR-4736	CLIP-seq
MIRT2332689	hsa-miR-4741	CLIP-seq
MIRT1368566	hsa-miR-4746-3p	CLIP-seq
MIRT2332690	hsa-miR-4751	CLIP-seq
MIRT1368568	hsa-miR-4763-3p	CLIP-seq
MIRT1368569	hsa-miR-4779	CLIP-seq
MIRT2109568	hsa-miR-4782-5p	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT1368571	hsa-miR-4786-5p	CLIP-seq
MIRT2332691	hsa-miR-4801	CLIP-seq
MIRT2332692	hsa-miR-495	CLIP-seq
MIRT1368572	hsa-miR-5095	CLIP-seq
MIRT2109570	hsa-miR-516b	CLIP-seq
MIRT2332693	hsa-miR-541	CLIP-seq
MIRT2332694	hsa-miR-542-3p	CLIP-seq
MIRT2332695	hsa-miR-550a	CLIP-seq
MIRT2332696	hsa-miR-603	CLIP-seq
MIRT2332697	hsa-miR-608	CLIP-seq
MIRT2332698	hsa-miR-611	CLIP-seq
MIRT1368573	hsa-miR-625	CLIP-seq
MIRT1368575	hsa-miR-646	CLIP-seq
MIRT2332699	hsa-miR-654-5p	CLIP-seq
MIRT2332700	hsa-miR-711	CLIP-seq
MIRT1368576	hsa-miR-759	CLIP-seq
MIRT1368577	hsa-miR-761	CLIP-seq
MIRT1368578	hsa-miR-765	CLIP-seq
MIRT1368579	hsa-miR-769-5p	CLIP-seq
MIRT1368580	hsa-miR-877	CLIP-seq
MIRT1368581	hsa-miR-885-3p	CLIP-seq
MIRT1368582	hsa-miR-922	CLIP-seq
MIRT1368583	hsa-miR-92a	CLIP-seq
MIRT1368584	hsa-miR-92b	CLIP-seq
MIRT1368585	hsa-miR-940	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT2109523	hsa-miR-1299	CLIP-seq
MIRT1368503	hsa-miR-1827	CLIP-seq
MIRT1368506	hsa-miR-214	CLIP-seq
MIRT2109529	hsa-miR-2682	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT1368514	hsa-miR-3182	CLIP-seq
MIRT1368518	hsa-miR-335	CLIP-seq
MIRT1368520	hsa-miR-3619-5p	CLIP-seq
MIRT2109537	hsa-miR-3665	CLIP-seq
MIRT1368524	hsa-miR-3686	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT1368530	hsa-miR-4328	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT1368533	hsa-miR-4438	CLIP-seq
MIRT2394823	hsa-miR-4480	CLIP-seq
MIRT2109550	hsa-miR-449c	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368542	hsa-miR-4514	CLIP-seq
MIRT1368551	hsa-miR-4659a-3p	CLIP-seq
MIRT1368552	hsa-miR-4659b-3p	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT1368558	hsa-miR-4692	CLIP-seq
MIRT1368565	hsa-miR-4736	CLIP-seq
MIRT2109568	hsa-miR-4782-5p	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT1368572	hsa-miR-5095	CLIP-seq
MIRT2109570	hsa-miR-516b	CLIP-seq
MIRT2332693	hsa-miR-541	CLIP-seq
MIRT1368575	hsa-miR-646	CLIP-seq
MIRT2332699	hsa-miR-654-5p	CLIP-seq
MIRT1368576	hsa-miR-759	CLIP-seq
MIRT1368577	hsa-miR-761	CLIP-seq
MIRT2109571	hsa-miR-764	CLIP-seq
MIRT1368581	hsa-miR-885-3p	CLIP-seq
MIRT1368582	hsa-miR-922	CLIP-seq
MIRT1368585	hsa-miR-940	CLIP-seq
MIRT2109522	hsa-miR-1245b-3p	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT2109539	hsa-miR-3915	CLIP-seq
MIRT2109542	hsa-miR-3928	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT2459930	hsa-miR-1225-3p	CLIP-seq
MIRT1368497	hsa-miR-1280	CLIP-seq
MIRT1368498	hsa-miR-1281	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT1368560	hsa-miR-4713-5p	CLIP-seq
MIRT2459931	hsa-miR-873	CLIP-seq
MIRT2459932	hsa-miR-939	CLIP-seq
MIRT2109521	hsa-miR-1208	CLIP-seq
MIRT1368492	hsa-miR-122	CLIP-seq
MIRT2459930	hsa-miR-1225-3p	CLIP-seq
MIRT2109522	hsa-miR-1245b-3p	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT2109523	hsa-miR-1299	CLIP-seq
MIRT1368503	hsa-miR-1827	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT2332664	hsa-miR-3157-5p	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT2109539	hsa-miR-3915	CLIP-seq
MIRT2109542	hsa-miR-3928	CLIP-seq
MIRT2627156	hsa-miR-3943	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368550	hsa-miR-4653-3p	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT2332683	hsa-miR-4691-3p	CLIP-seq
MIRT1368569	hsa-miR-4779	CLIP-seq
MIRT2109568	hsa-miR-4782-5p	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT2109570	hsa-miR-516b	CLIP-seq
MIRT2459931	hsa-miR-873	CLIP-seq
MIRT1368580	hsa-miR-877	CLIP-seq
MIRT2459932	hsa-miR-939	CLIP-seq
MIRT1368492	hsa-miR-122	CLIP-seq
MIRT2459930	hsa-miR-1225-3p	CLIP-seq
MIRT1368500	hsa-miR-1294	CLIP-seq
MIRT2109523	hsa-miR-1299	CLIP-seq
MIRT1368504	hsa-miR-1915	CLIP-seq
MIRT1368511	hsa-miR-3150b-3p	CLIP-seq
MIRT2109533	hsa-miR-3202	CLIP-seq
MIRT1368529	hsa-miR-4316	CLIP-seq
MIRT2691309	hsa-miR-4323	CLIP-seq
MIRT1368531	hsa-miR-4419a	CLIP-seq
MIRT2109548	hsa-miR-4476	CLIP-seq
MIRT1368541	hsa-miR-4510	CLIP-seq
MIRT1368550	hsa-miR-4653-3p	CLIP-seq
MIRT1368556	hsa-miR-4689	CLIP-seq
MIRT2691310	hsa-miR-4713-3p	CLIP-seq
MIRT1368569	hsa-miR-4779	CLIP-seq
MIRT2109568	hsa-miR-4782-5p	CLIP-seq
MIRT1368570	hsa-miR-4784	CLIP-seq
MIRT2109570	hsa-miR-516b	CLIP-seq
MIRT2459931	hsa-miR-873	CLIP-seq
MIRT2459932	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PPARA	Unknown	19958503
PPARG	Repression	19887620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0005515	Function	Protein binding	IPI	8901634, 11350981, 11696366, 12809501, 15035633, 16710297, 21392185, 30287853, 31912575, 33961781
GO:0005516	Function	Calmodulin binding	IEA
GO:0005543	Function	Phospholipid binding	IDA	22020933
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	TAS	17565280
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21553168
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15035633, 21553168, 24840010
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006883	Process	Intracellular sodium ion homeostasis	IDA	24840010
GO:0006885	Process	Regulation of pH	IDA	8901634
GO:0006885	Process	Regulation of pH	IEA
GO:0006885	Process	Regulation of pH	IEA
GO:0006885	Process	Regulation of pH	TAS	8283968
GO:0009986	Component	Cell surface	IEA
GO:0010447	Process	Response to acidic pH	IDA	8901634
GO:0010447	Process	Response to acidic pH	IEA
GO:0010447	Process	Response to acidic pH	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IMP	21359875
GO:0010882	Process	Regulation of cardiac muscle contraction by calcium ion signaling	IMP	15105296
GO:0014704	Component	Intercalated disc	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	IBA
GO:0015385	Function	Sodium:proton antiporter activity	IDA	2536298, 8901634, 11350981, 24840010
GO:0015385	Function	Sodium:proton antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	ISS
GO:0015385	Function	Sodium:proton antiporter activity	TAS	24840010
GO:0015386	Function	Potassium:proton antiporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8283968
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016477	Process	Cell migration	TAS	17565280
GO:0030011	Process	Maintenance of cell polarity	TAS	17565280
GO:0030027	Component	Lamellipodium	TAS	17565280
GO:0030154	Process	Cell differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030315	Component	T-tubule	IEA
GO:0030346	Function	Protein phosphatase 2B binding	IDA	22688515
GO:0030346	Function	Protein phosphatase 2B binding	IPI	22688515
GO:0030674	Function	Protein-macromolecule adaptor activity	TAS	17565280
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0035794	Process	Positive regulation of mitochondrial membrane permeability	IEA
GO:0035994	Process	Response to muscle stretch	IMP	15105296
GO:0036376	Process	Sodium ion export across plasma membrane	ISS
GO:0042383	Component	Sarcolemma	IEA
GO:0042802	Function	Identical protein binding	IDA	17073455, 34108458
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045121	Component	Membrane raft	IDA	22688515
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22688515
GO:0048306	Function	Calcium-dependent protein binding	IDA	15035633
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0051259	Process	Protein complex oligomerization	ISS
GO:0051453	Process	Regulation of intracellular pH	IBA
GO:0051453	Process	Regulation of intracellular pH	IDA	15035633, 24840010
GO:0051453	Process	Regulation of intracellular pH	IEA
GO:0051492	Process	Regulation of stress fiber assembly	TAS	17565280
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	17565280
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060090	Function	Molecular adaptor activity	TAS	17565280
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070417	Process	Cellular response to cold	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	22688515
GO:0071236	Process	Cellular response to antibiotic	IEA
GO:0071257	Process	Cellular response to electrical stimulus	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	TAS	17565280
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071468	Process	Cellular response to acidic pH	IDA	24840010
GO:0071468	Process	Cellular response to acidic pH	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071872	Process	Cellular response to epinephrine stimulus	IMP	21359875
GO:0086003	Process	Cardiac muscle cell contraction	IEA
GO:0086036	Process	Regulation of cardiac muscle cell membrane potential	TAS	24840010
GO:0086092	Process	Regulation of the force of heart contraction by cardiac conduction	IMP	21359875
GO:0090533	Component	Cation-transporting ATPase complex	IDA	24840010
GO:0098719	Process	Sodium ion import across plasma membrane	IBA
GO:0098719	Process	Sodium ion import across plasma membrane	IDA	2536298, 24840010
GO:0098735	Process	Positive regulation of the force of heart contraction	IMP	15105296
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1902600	Process	Proton transmembrane transport	IDA	24840010
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990351	Component	Transporter complex	IEA

Other IDs

• MIM: 107310
• HGNC: 11071
• e!Ensembl: ENSG00000090020

Protein

• UniProt ID: P19634
• Protein name: Sodium/hydrogen exchanger 1 (APNH) (Na(+)/H(+) antiporter, amiloride-sensitive) (Na(+)/H(+) exchanger 1) (NHE-1) (Solute carrier family 9 member 1)
• Protein function: Electroneutral Na(+) /H(+) antiporter that extrudes Na(+) in exchange for external protons driven by the inward sodium ion chemical gradient, protecting cells from acidification that occurs from metabolism (PubMed:11350981, PubMed:11532004, PubM
• PDB: 1Y4E, 2BEC, 2E30, 2HTG, 2KBV, 2L0E, 2MDF, 2YGG, 6BJF, 6NUC, 6NUF, 6NUU, 6ZBI, 7DSV, 7DSW, 7DSX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00999	Na_H_Exchanger	105 → 505	Sodium/hydrogen exchanger family	Family
  PF16644	NEXCaM_BD	599 → 700	Regulatory region of Na+/H+ exchanger NHE binds to calmodulin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Kidney and intestine.
• Sequence:

  MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
  TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
  VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
  QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
  AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
  VALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
  VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
  CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
  LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
  YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
  VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
  EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
  PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
  APSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ

• Sequence length: 815

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Lichtenstein-Knorr syndrome	Likely pathogenic; Pathogenic	rs1221107969, rs786204831, rs2083214834	RCV001806784 RCV000169735 RCV001256015	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BARRETT ESOPHAGUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBELLAR DYSFUNCTION WITH VARIABLE COGNITIVE AND BEHAVIORAL ABNORMALITIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE AUTOSOMAL RECESSIVE CEREBELLAR ATAXIA, SENSORINEURAL HEARING LOSS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC9A1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	22718548		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	37684281	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24594116, 30367511, 30695730, 31484936		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24594116, 30367511, 30695730, 31484936		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	CTD_human_DG	21127259		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20876775		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	20876775	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	CTD_human_DG	21127259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	19887620, 20542029, 21669197, 23902689, 25143433, 25514463, 27176613, 27521504, 27751915, 30849956, 31091671		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15843433, 17332506, 26646587, 27266704, 29895196	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	35339998	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30405813		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	35334035	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30029588		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19949839		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23224899		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17894388, 21997166, 26397063		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17894388, 21997166, 26397063		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	22718548		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10642288		★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18942765, 31694264		★☆☆☆☆ Found in Text Mining only
Congenital secretory diarrhea, sodium type (disorder)	Congenital secretory diarrhea	BEFREE	11113072		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11964375, 18776042, 28727929, 29038209, 30519189, 31052504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	19027022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30594602		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31067690		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30471113		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31068571		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29227582		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29227582		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33426802	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19887620		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	10886567	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37916327	Stimulate	★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28222424		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28467979		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26965387		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30405813		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27902974	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	7875760		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	7875760	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24717311, 30333031		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28732990	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24717311, 30333031		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10751317, 12693711, 27287871, 40459830	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30262908, 30333031		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17981808, 18077454	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	31091671		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11964375, 18776042, 28727929, 29038209, 30519189, 31052504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	LHGDN	18776042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	19027022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	19027022		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30405813		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24278418		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12682826		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	7875760	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	21454803	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10930182, 21454803, 8227369		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	19111554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30029588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	19111554		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30029588		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21454803, 35334035	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21454803	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22216126	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28806945	Inhibit	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30838887		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18942765		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18942765		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33843785	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30043461, 30592266		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	8201013	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10642288		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	19027022		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10913675, 24188478, 24608976, 25043809, 25802333		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35624145	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35624145	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24608976, 31561854		★☆☆☆☆ Found in Text Mining only
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	BEFREE	25205112, 30018422		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	ORPHANET_DG	25205112		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	UNIPROT_DG	25205112, 30237576		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LICHTENSTEIN-KNORR SYNDROME	Lichtenstein-knorr syndrome	GENOMICS_ENGLAND_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Liver carcinoma	Liver carcinoma	BEFREE	19876777, 20151228, 21261728		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21454803	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37921568	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19887620, 20542029, 21669197, 23902689, 25143433, 25514463, 27176613, 27521504, 27751915, 30849956, 31091671		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28467979		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20138826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27529686, 28098891		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22120673, 22360557, 22718548, 22907202, 24493748, 24717311, 25275700, 26944480, 27176613, 27739355, 27773735, 28007556, 28098891, 28268168, 28806945, 28943936, 30471113, 30849956, 31357694, 31480530		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17894388, 21997166, 26397063		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15090545, 27751915		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15535843, 15843433, 17332506		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11248216, 17916606, 29558744	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17916606, 24173371, 25275700, 28205573, 29558744, 29802798, 31728131		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17916606		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31068571		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36814107	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	19027022		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31067690		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	12542207		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11053239, 11161003, 17894388, 19876777, 19887620, 20151228, 21261728, 22076128, 22718548, 25372487, 25802333, 27521504, 27902974, 28055960, 28806945, 29363134, 29802798, 30078401, 30262908, 30333031, 30405813, 31595389		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	22718548		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27773735	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20138826		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19393580	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28943936		★☆☆☆☆ Found in Text Mining only
Progressive autosomal recessive ataxia-deafness syndrome	Ataxia-Deafness Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30594602		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30018422		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19360300		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27902974		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28268168		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18407588, 27529686, 28098891		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30838887		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25514463, 27049728, 27521504, 27751915, 28104391, 29363134		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27049728	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21221801		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	BEFREE	31067690		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	22718548		★☆☆☆☆ Found in Text Mining only