SLC8B1 (solute carrier family 8 member B1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80024
• Gene name: Solute carrier family 8 member B1
• Gene symbol: SLC8B1
• Synonyms (NCBI Gene): NCKX6, NCLX, SLC24A6
• Chromosome: 12
• Chromosome location: 12q24.13
• Summary: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281

Gene ontology (GO) Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005432	Function	Calcium:sodium antiporter activity	IBA
GO:0005432	Function	Calcium:sodium antiporter activity	IDA	15060069, 23056385, 24898248, 28130126, 28219928
GO:0005432	Function	Calcium:sodium antiporter activity	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	IMP	20018762
GO:0005432	Function	Calcium:sodium antiporter activity	TAS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	IDA	23056385, 24898248
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	IEA
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	IMP	20018762
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	TAS
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0015368	Function	Calcium:monoatomic cation antiporter activity	TAS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030061	Component	Mitochondrial crista	IDA	20018762
GO:0030061	Component	Mitochondrial crista	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	23056385
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042593	Process	Glucose homeostasis	IDA	23056385
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20018762
GO:0050796	Process	Regulation of insulin secretion	IDA	23056385
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IMP	20018762
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IDA	24898248
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IEA
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IMP	20018762
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0086036	Process	Regulation of cardiac muscle cell membrane potential	IMP	20018762
GO:0086038	Function	Calcium:sodium antiporter activity involved in regulation of cardiac muscle cell membrane potential	IEA
GO:0086038	Function	Calcium:sodium antiporter activity involved in regulation of cardiac muscle cell membrane potential	ISS
GO:0099093	Process	Calcium export from the mitochondrion	IBA
GO:0099093	Process	Calcium export from the mitochondrion	IDA	24898248
GO:0099093	Process	Calcium export from the mitochondrion	IEA
GO:1901623	Process	Regulation of lymphocyte chemotaxis	IEA
GO:1901623	Process	Regulation of lymphocyte chemotaxis	ISS
GO:2001256	Process	Regulation of store-operated calcium entry	IDA	28219928

Other IDs

• MIM: 609841
• HGNC: 26175
• e!Ensembl: ENSG00000089060

Protein

• UniProt ID: Q6J4K2
• Protein name: Mitochondrial sodium/calcium exchanger protein (Na(+)/K(+)/Ca(2+)-exchange protein 6) (Sodium/calcium exchanger protein, mitochondrial) (Sodium/potassium/calcium exchanger 6) (Solute carrier family 24 member 6) (Solute carrier family 8 member B1)
• Protein function: Mitochondrial sodium/calcium antiporter that mediates sodium-dependent calcium efflux from mitochondrion, by mediating the exchange of 3 sodium ions per 1 calcium ion (PubMed:15060069, PubMed:20018762, PubMed:22829870, PubMed:23056385, PubMed:24
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01699	Na_Ca_ex	421 → 573	Sodium/calcium exchanger protein	Family
  PF01699	Na_Ca_ex	103 → 246	Sodium/calcium exchanger protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Present in pancreatic beta-cells (at protein level). {ECO:0000269|PubMed:23056385}.
• Sequence:

  MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLN
  VSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK
  FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVL
  VTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFY
  VVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQET
  TAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNC
  LHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL
  FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLAR
  QGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVF
  SLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHLKSM

• Sequence length: 584

Pathways

Reactome Pathway

Sodium/Calcium exchangers

Mitochondrial calcium ion transport

Related Genes

No strongly related genes found yet for SLC8B1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC8B1.