SLC8A1 (solute carrier family 8 member A1)

Gene

• Entrez ID: 6546
• Gene name: Solute carrier family 8 member A1
• Gene symbol: SLC8A1
• Synonyms (NCBI Gene): NCX1
• Chromosome: 2
• Chromosome location: 2p22.1
• Summary: In cardiac myocytes, Ca(2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca(2+) concentration during contraction is primarily due to release of Ca(2+) from intracellular stores. However,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006819	hsa-miR-1-3p	Luciferase reporter assay, Western blot	22362515
MIRT510749	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT510745	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510744	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510742	hsa-miR-3924	HITS-CLIP	21572407
MIRT510743	hsa-miR-590-3p	HITS-CLIP	21572407
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT641916	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT641915	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636223	hsa-miR-6124	HITS-CLIP	23824327
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT636224	hsa-miR-4282	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636223	hsa-miR-6124	HITS-CLIP	23824327
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT510749	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT510743	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT554159	hsa-miR-4775	PAR-CLIP	21572407
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510742	hsa-miR-3924	PAR-CLIP	21572407
MIRT534184	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT534183	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT534182	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT534181	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT534180	hsa-miR-3135a	PAR-CLIP	22012620
MIRT534179	hsa-miR-6822-3p	PAR-CLIP	22012620
MIRT534178	hsa-miR-760	PAR-CLIP	22012620
MIRT534177	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT534176	hsa-miR-8057	PAR-CLIP	22012620
MIRT534175	hsa-miR-5693	PAR-CLIP	22012620
MIRT534174	hsa-miR-6888-5p	PAR-CLIP	22012620
MIRT534173	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT534172	hsa-miR-6847-5p	PAR-CLIP	22012620
MIRT534171	hsa-miR-1825	PAR-CLIP	22012620
MIRT534170	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT534169	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT534168	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT534167	hsa-miR-3150b-3p	PAR-CLIP	22012620
MIRT534166	hsa-miR-4784	PAR-CLIP	22012620
MIRT534165	hsa-miR-4683	PAR-CLIP	22012620
MIRT510749	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT510748	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT510747	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT510746	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521019	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510742	hsa-miR-3924	PAR-CLIP	23446348
MIRT510743	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT510749	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT510748	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT510747	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT510746	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510742	hsa-miR-3924	PAR-CLIP	23446348
MIRT510743	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT450666	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448463	hsa-miR-507	PAR-CLIP	22100165
MIRT448462	hsa-miR-557	PAR-CLIP	22100165
MIRT448463	hsa-miR-507	PAR-CLIP	22100165
MIRT448462	hsa-miR-557	PAR-CLIP	22100165
MIRT510749	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT510745	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510744	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510742	hsa-miR-3924	HITS-CLIP	21572407
MIRT510743	hsa-miR-590-3p	HITS-CLIP	21572407
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT641916	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT641915	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636223	hsa-miR-6124	HITS-CLIP	23824327
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT636224	hsa-miR-4282	HITS-CLIP	23824327
MIRT636225	hsa-miR-3148	HITS-CLIP	23824327
MIRT636223	hsa-miR-6124	HITS-CLIP	23824327
MIRT636222	hsa-miR-3161	HITS-CLIP	23824327
MIRT636221	hsa-miR-3978	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT622180	hsa-miR-599	HITS-CLIP	23824327
MIRT622179	hsa-miR-1305	HITS-CLIP	23824327
MIRT622178	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT510749	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT510743	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT554159	hsa-miR-4775	PAR-CLIP	21572407
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510742	hsa-miR-3924	PAR-CLIP	21572407
MIRT534184	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT534183	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT534182	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT534181	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT534180	hsa-miR-3135a	PAR-CLIP	22012620
MIRT534179	hsa-miR-6822-3p	PAR-CLIP	22012620
MIRT534178	hsa-miR-760	PAR-CLIP	22012620
MIRT534177	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT534176	hsa-miR-8057	PAR-CLIP	22012620
MIRT534175	hsa-miR-5693	PAR-CLIP	22012620
MIRT534174	hsa-miR-6888-5p	PAR-CLIP	22012620
MIRT534173	hsa-miR-512-3p	PAR-CLIP	22012620
MIRT534172	hsa-miR-6847-5p	PAR-CLIP	22012620
MIRT534171	hsa-miR-1825	PAR-CLIP	22012620
MIRT534170	hsa-miR-199a-5p	PAR-CLIP	22012620
MIRT534169	hsa-miR-199b-5p	PAR-CLIP	22012620
MIRT534168	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT534167	hsa-miR-3150b-3p	PAR-CLIP	22012620
MIRT534166	hsa-miR-4784	PAR-CLIP	22012620
MIRT534165	hsa-miR-4683	PAR-CLIP	22012620
MIRT510749	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT510748	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT510747	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT510746	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521019	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510742	hsa-miR-3924	PAR-CLIP	23446348
MIRT510743	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT510749	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT510748	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT510747	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT510746	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT510745	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510744	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510742	hsa-miR-3924	PAR-CLIP	23446348
MIRT510743	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT450666	hsa-miR-1273e	PAR-CLIP	22100165
MIRT448463	hsa-miR-507	PAR-CLIP	22100165
MIRT448462	hsa-miR-557	PAR-CLIP	22100165
MIRT448463	hsa-miR-507	PAR-CLIP	22100165
MIRT448462	hsa-miR-557	PAR-CLIP	22100165
MIRT006819	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR	36035156
MIRT1368403	hsa-miR-1193	CLIP-seq
MIRT1368404	hsa-miR-1225-5p	CLIP-seq
MIRT1368405	hsa-miR-1227	CLIP-seq
MIRT1368406	hsa-miR-1275	CLIP-seq
MIRT1368407	hsa-miR-1324	CLIP-seq
MIRT1368408	hsa-miR-148a	CLIP-seq
MIRT1368409	hsa-miR-148b	CLIP-seq
MIRT1368410	hsa-miR-152	CLIP-seq
MIRT1368411	hsa-miR-186	CLIP-seq
MIRT1368412	hsa-miR-197	CLIP-seq
MIRT1368413	hsa-miR-218	CLIP-seq
MIRT1368414	hsa-miR-3133	CLIP-seq
MIRT1368415	hsa-miR-3140-3p	CLIP-seq
MIRT1368416	hsa-miR-3152-5p	CLIP-seq
MIRT1368417	hsa-miR-3160-5p	CLIP-seq
MIRT1368418	hsa-miR-3170	CLIP-seq
MIRT1368419	hsa-miR-3183	CLIP-seq
MIRT1368420	hsa-miR-3184	CLIP-seq
MIRT1368421	hsa-miR-3674	CLIP-seq
MIRT1368422	hsa-miR-3689d	CLIP-seq
MIRT1368423	hsa-miR-3692	CLIP-seq
MIRT1368424	hsa-miR-378g	CLIP-seq
MIRT1368425	hsa-miR-423-5p	CLIP-seq
MIRT1368426	hsa-miR-4279	CLIP-seq
MIRT1368427	hsa-miR-4426	CLIP-seq
MIRT1368428	hsa-miR-4525	CLIP-seq
MIRT1368429	hsa-miR-4647	CLIP-seq
MIRT1368430	hsa-miR-4662b	CLIP-seq
MIRT1368431	hsa-miR-4665-5p	CLIP-seq
MIRT1368432	hsa-miR-4703-3p	CLIP-seq
MIRT1368433	hsa-miR-4710	CLIP-seq
MIRT1368434	hsa-miR-4716-3p	CLIP-seq
MIRT1368435	hsa-miR-4723-3p	CLIP-seq
MIRT1368436	hsa-miR-4723-5p	CLIP-seq
MIRT1368437	hsa-miR-4763-5p	CLIP-seq
MIRT1368438	hsa-miR-4774-3p	CLIP-seq
MIRT1368439	hsa-miR-4790-3p	CLIP-seq
MIRT1368440	hsa-miR-485-3p	CLIP-seq
MIRT1368441	hsa-miR-509-3p	CLIP-seq
MIRT1368442	hsa-miR-5096	CLIP-seq
MIRT1368443	hsa-miR-570	CLIP-seq
MIRT1368444	hsa-miR-625	CLIP-seq
MIRT1368445	hsa-miR-635	CLIP-seq
MIRT1368446	hsa-miR-636	CLIP-seq
MIRT1368406	hsa-miR-1275	CLIP-seq
MIRT1368447	hsa-miR-3163	CLIP-seq
MIRT1368420	hsa-miR-3184	CLIP-seq
MIRT1368448	hsa-miR-3646	CLIP-seq
MIRT1368449	hsa-miR-3647-3p	CLIP-seq
MIRT1368450	hsa-miR-3662	CLIP-seq
MIRT1368422	hsa-miR-3689d	CLIP-seq
MIRT1368425	hsa-miR-423-5p	CLIP-seq
MIRT1368428	hsa-miR-4525	CLIP-seq
MIRT1368431	hsa-miR-4665-5p	CLIP-seq
MIRT1368433	hsa-miR-4710	CLIP-seq
MIRT1368434	hsa-miR-4716-3p	CLIP-seq
MIRT1368436	hsa-miR-4723-5p	CLIP-seq
MIRT1368451	hsa-miR-4773	CLIP-seq
MIRT1368452	hsa-miR-495	CLIP-seq
MIRT1368444	hsa-miR-625	CLIP-seq
MIRT2109505	hsa-miR-4291	CLIP-seq
MIRT2109506	hsa-miR-4528	CLIP-seq
MIRT2109507	hsa-miR-4659a-3p	CLIP-seq
MIRT2109508	hsa-miR-4659b-3p	CLIP-seq
MIRT2109509	hsa-miR-885-5p	CLIP-seq
MIRT1368405	hsa-miR-1227	CLIP-seq
MIRT2332619	hsa-miR-1303	CLIP-seq
MIRT1368407	hsa-miR-1324	CLIP-seq
MIRT1368408	hsa-miR-148a	CLIP-seq
MIRT1368409	hsa-miR-148b	CLIP-seq
MIRT1368410	hsa-miR-152	CLIP-seq
MIRT1368412	hsa-miR-197	CLIP-seq
MIRT2332620	hsa-miR-4502	CLIP-seq
MIRT2332621	hsa-miR-455-3p	CLIP-seq
MIRT2332622	hsa-miR-4646-5p	CLIP-seq
MIRT2332623	hsa-miR-4757-5p	CLIP-seq
MIRT1368442	hsa-miR-5096	CLIP-seq
MIRT2332624	hsa-miR-877	CLIP-seq
MIRT2332625	hsa-miR-892a	CLIP-seq
MIRT2459927	hsa-miR-2392	CLIP-seq
MIRT2459928	hsa-miR-4533	CLIP-seq
MIRT2459929	hsa-miR-4747-5p	CLIP-seq
MIRT2627055	hsa-miR-106a	CLIP-seq
MIRT2627056	hsa-miR-106b	CLIP-seq
MIRT2627057	hsa-miR-1203	CLIP-seq
MIRT2627058	hsa-miR-1207-5p	CLIP-seq
MIRT2627059	hsa-miR-130a	CLIP-seq
MIRT2627060	hsa-miR-130b	CLIP-seq
MIRT2627061	hsa-miR-1343	CLIP-seq
MIRT2627062	hsa-miR-137	CLIP-seq
MIRT2627063	hsa-miR-149	CLIP-seq
MIRT2627064	hsa-miR-150	CLIP-seq
MIRT2627065	hsa-miR-153	CLIP-seq
MIRT2627066	hsa-miR-155	CLIP-seq
MIRT2627067	hsa-miR-17	CLIP-seq
MIRT1368411	hsa-miR-186	CLIP-seq
MIRT2627068	hsa-miR-188-5p	CLIP-seq
MIRT2627069	hsa-miR-19a	CLIP-seq
MIRT2627070	hsa-miR-19b	CLIP-seq
MIRT2627071	hsa-miR-2053	CLIP-seq
MIRT2627072	hsa-miR-20a	CLIP-seq
MIRT2627073	hsa-miR-20b	CLIP-seq
MIRT1368413	hsa-miR-218	CLIP-seq
MIRT2627074	hsa-miR-219-2-3p	CLIP-seq
MIRT2627075	hsa-miR-23a	CLIP-seq
MIRT2627076	hsa-miR-23b	CLIP-seq
MIRT2627077	hsa-miR-23c	CLIP-seq
MIRT2627078	hsa-miR-298	CLIP-seq
MIRT2627079	hsa-miR-301a	CLIP-seq
MIRT2627080	hsa-miR-301b	CLIP-seq
MIRT2627081	hsa-miR-3065-5p	CLIP-seq
MIRT2627082	hsa-miR-3074-3p	CLIP-seq
MIRT2627083	hsa-miR-3074-5p	CLIP-seq
MIRT2627084	hsa-miR-3138	CLIP-seq
MIRT1368415	hsa-miR-3140-3p	CLIP-seq
MIRT2627085	hsa-miR-3167	CLIP-seq
MIRT1368418	hsa-miR-3170	CLIP-seq
MIRT2627086	hsa-miR-338-3p	CLIP-seq
MIRT2627087	hsa-miR-3609	CLIP-seq
MIRT2627088	hsa-miR-3613-3p	CLIP-seq
MIRT2627089	hsa-miR-3614-3p	CLIP-seq
MIRT2627090	hsa-miR-361-5p	CLIP-seq
MIRT2627091	hsa-miR-3617	CLIP-seq
MIRT1368448	hsa-miR-3646	CLIP-seq
MIRT1368450	hsa-miR-3662	CLIP-seq
MIRT2627092	hsa-miR-3665	CLIP-seq
MIRT2627093	hsa-miR-3666	CLIP-seq
MIRT2627094	hsa-miR-3688-3p	CLIP-seq
MIRT2627095	hsa-miR-371b-5p	CLIP-seq
MIRT2627096	hsa-miR-374c	CLIP-seq
MIRT2627097	hsa-miR-3928	CLIP-seq
MIRT2627098	hsa-miR-3944-5p	CLIP-seq
MIRT2627099	hsa-miR-3977	CLIP-seq
MIRT2627100	hsa-miR-4265	CLIP-seq
MIRT1368426	hsa-miR-4279	CLIP-seq
MIRT2627101	hsa-miR-4295	CLIP-seq
MIRT2627102	hsa-miR-4296	CLIP-seq
MIRT2627103	hsa-miR-4310	CLIP-seq
MIRT2627104	hsa-miR-4317	CLIP-seq
MIRT2627105	hsa-miR-4322	CLIP-seq
MIRT2627106	hsa-miR-4417	CLIP-seq
MIRT1368427	hsa-miR-4426	CLIP-seq
MIRT2627107	hsa-miR-4437	CLIP-seq
MIRT2627108	hsa-miR-4459	CLIP-seq
MIRT2627109	hsa-miR-4477a	CLIP-seq
MIRT2627110	hsa-miR-448	CLIP-seq
MIRT2627111	hsa-miR-4494	CLIP-seq
MIRT2627112	hsa-miR-452	CLIP-seq
MIRT2627113	hsa-miR-4520a-3p	CLIP-seq
MIRT2627114	hsa-miR-4522	CLIP-seq
MIRT2627115	hsa-miR-454	CLIP-seq
MIRT2627116	hsa-miR-4640-5p	CLIP-seq
MIRT2627117	hsa-miR-4643	CLIP-seq
MIRT2627118	hsa-miR-4645-3p	CLIP-seq
MIRT1368429	hsa-miR-4647	CLIP-seq
MIRT2109507	hsa-miR-4659a-3p	CLIP-seq
MIRT2109508	hsa-miR-4659b-3p	CLIP-seq
MIRT1368430	hsa-miR-4662b	CLIP-seq
MIRT2627119	hsa-miR-4676-3p	CLIP-seq
MIRT2627120	hsa-miR-4693-5p	CLIP-seq
MIRT2627121	hsa-miR-4694-3p	CLIP-seq
MIRT2627122	hsa-miR-4698	CLIP-seq
MIRT2627123	hsa-miR-4704-3p	CLIP-seq
MIRT2627124	hsa-miR-4713-5p	CLIP-seq
MIRT2627125	hsa-miR-4717-3p	CLIP-seq
MIRT2627126	hsa-miR-4726-5p	CLIP-seq
MIRT2627127	hsa-miR-4736	CLIP-seq
MIRT2627128	hsa-miR-4755-3p	CLIP-seq
MIRT2627129	hsa-miR-4763-3p	CLIP-seq
MIRT2627130	hsa-miR-4777-5p	CLIP-seq
MIRT2627131	hsa-miR-4778-3p	CLIP-seq
MIRT1368439	hsa-miR-4790-3p	CLIP-seq
MIRT2627132	hsa-miR-4796-3p	CLIP-seq
MIRT1368452	hsa-miR-495	CLIP-seq
MIRT2627133	hsa-miR-499a-5p	CLIP-seq
MIRT2627134	hsa-miR-518d-5p	CLIP-seq
MIRT2627135	hsa-miR-519b-5p	CLIP-seq
MIRT2627136	hsa-miR-519c-5p	CLIP-seq
MIRT2627137	hsa-miR-519d	CLIP-seq
MIRT2627138	hsa-miR-520c-5p	CLIP-seq
MIRT2627139	hsa-miR-526a	CLIP-seq
MIRT2627140	hsa-miR-532-3p	CLIP-seq
MIRT2627141	hsa-miR-548ad	CLIP-seq
MIRT2627142	hsa-miR-548ah	CLIP-seq
MIRT2627143	hsa-miR-550b	CLIP-seq
MIRT2627144	hsa-miR-555	CLIP-seq
MIRT2627145	hsa-miR-569	CLIP-seq
MIRT2627146	hsa-miR-577	CLIP-seq
MIRT2627147	hsa-miR-595	CLIP-seq
MIRT2627148	hsa-miR-628-3p	CLIP-seq
MIRT2627149	hsa-miR-634	CLIP-seq
MIRT1368446	hsa-miR-636	CLIP-seq
MIRT2627150	hsa-miR-641	CLIP-seq
MIRT2627151	hsa-miR-642b	CLIP-seq
MIRT2627152	hsa-miR-655	CLIP-seq
MIRT2627153	hsa-miR-876-5p	CLIP-seq
MIRT2627154	hsa-miR-9	CLIP-seq
MIRT2627155	hsa-miR-93	CLIP-seq
MIRT2627075	hsa-miR-23a	CLIP-seq
MIRT2627076	hsa-miR-23b	CLIP-seq
MIRT2627077	hsa-miR-23c	CLIP-seq
MIRT2627098	hsa-miR-3944-5p	CLIP-seq
MIRT1368427	hsa-miR-4426	CLIP-seq
MIRT1368429	hsa-miR-4647	CLIP-seq
MIRT2109507	hsa-miR-4659a-3p	CLIP-seq
MIRT2109508	hsa-miR-4659b-3p	CLIP-seq
MIRT1368430	hsa-miR-4662b	CLIP-seq
MIRT2627131	hsa-miR-4778-3p	CLIP-seq
MIRT1368405	hsa-miR-1227	CLIP-seq
MIRT1368407	hsa-miR-1324	CLIP-seq
MIRT1368408	hsa-miR-148a	CLIP-seq
MIRT1368409	hsa-miR-148b	CLIP-seq
MIRT1368410	hsa-miR-152	CLIP-seq
MIRT2627066	hsa-miR-155	CLIP-seq
MIRT2627069	hsa-miR-19a	CLIP-seq
MIRT2627070	hsa-miR-19b	CLIP-seq
MIRT2627071	hsa-miR-2053	CLIP-seq
MIRT1368413	hsa-miR-218	CLIP-seq
MIRT1368415	hsa-miR-3140-3p	CLIP-seq
MIRT1368418	hsa-miR-3170	CLIP-seq
MIRT1368448	hsa-miR-3646	CLIP-seq
MIRT1368450	hsa-miR-3662	CLIP-seq
MIRT2627094	hsa-miR-3688-3p	CLIP-seq
MIRT2627112	hsa-miR-452	CLIP-seq
MIRT2627117	hsa-miR-4643	CLIP-seq
MIRT2627119	hsa-miR-4676-3p	CLIP-seq
MIRT2627120	hsa-miR-4693-5p	CLIP-seq
MIRT2627121	hsa-miR-4694-3p	CLIP-seq
MIRT2627125	hsa-miR-4717-3p	CLIP-seq
MIRT2627128	hsa-miR-4755-3p	CLIP-seq
MIRT1368439	hsa-miR-4790-3p	CLIP-seq
MIRT2627141	hsa-miR-548ad	CLIP-seq
MIRT2627143	hsa-miR-550b	CLIP-seq
MIRT2627145	hsa-miR-569	CLIP-seq
MIRT2691308	hsa-miR-576-3p	CLIP-seq
MIRT1368446	hsa-miR-636	CLIP-seq
MIRT2627151	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	IC	19481548
GO:0002026	Process	Regulation of the force of heart contraction	ISS
GO:0002027	Process	Regulation of heart rate	ISS
GO:0005432	Function	Calcium:sodium antiporter activity	IBA
GO:0005432	Function	Calcium:sodium antiporter activity	IDA	1374913, 19481548
GO:0005432	Function	Calcium:sodium antiporter activity	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	IMP	25589784
GO:0005432	Function	Calcium:sodium antiporter activity	TAS
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	16292983, 25589784, 31837246
GO:0005516	Function	Calmodulin binding	IDA	26421717
GO:0005516	Function	Calmodulin binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	1374913, 26421717
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	19095005
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006883	Process	Intracellular sodium ion homeostasis	IDA	1374913
GO:0006936	Process	Muscle contraction	TAS	1374913
GO:0007154	Process	Cell communication	IEA
GO:0008092	Function	Cytoskeletal protein binding	IDA	16292983
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010649	Process	Regulation of cell communication by electrical coupling	TAS	17614935
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	ISS
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	TAS	23608603
GO:0010882	Process	Regulation of cardiac muscle contraction by calcium ion signaling	TAS	23224879
GO:0014069	Component	Postsynaptic density	ISS
GO:0014704	Component	Intercalated disc	ISS
GO:0014704	Component	Intercalated disc	TAS	17614935
GO:0014829	Process	Vascular associated smooth muscle contraction	ISS
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030018	Component	Z disc	ISS
GO:0030315	Component	T-tubule	ISS
GO:0030315	Component	T-tubule	TAS	17614935
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0030501	Process	Positive regulation of bone mineralization	IMP	25589784
GO:0030506	Function	Ankyrin binding	IPI	17178715
GO:0030506	Function	Ankyrin binding	ISS
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	19481548
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IGI	25589784
GO:0035725	Process	Sodium ion transmembrane transport	IMP	25589784
GO:0035994	Process	Response to muscle stretch	IMP	15105296
GO:0036376	Process	Sodium ion export across plasma membrane	IDA	19481548
GO:0042383	Component	Sarcolemma	IBA
GO:0042383	Component	Sarcolemma	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0044325	Function	Transmembrane transporter binding	ISS
GO:0044557	Process	Relaxation of smooth muscle	ISS
GO:0045202	Component	Synapse	IDA	21382638
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051481	Process	Negative regulation of cytosolic calcium ion concentration	ISS
GO:0055013	Process	Cardiac muscle cell development	ISS
GO:0055074	Process	Calcium ion homeostasis	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0055119	Process	Relaxation of cardiac muscle	IC	19481548
GO:0055119	Process	Relaxation of cardiac muscle	TAS	23224879
GO:0060048	Process	Cardiac muscle contraction	TAS	23224879
GO:0060402	Process	Calcium ion transport into cytosol	ISS
GO:0070509	Process	Calcium ion import	IDA	1374913, 19481548
GO:0070588	Process	Calcium ion transmembrane transport	IGI	25589784
GO:0070588	Process	Calcium ion transmembrane transport	ISS
GO:0071313	Process	Cellular response to caffeine	ISS
GO:0071944	Component	Cell periphery	IDA	21321244
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	TAS	23608603
GO:0086064	Process	Cell communication by electrical coupling involved in cardiac conduction	ISS
GO:0097553	Process	Calcium ion transmembrane import into cytosol	TAS	19095005
GO:0098703	Process	Calcium ion import across plasma membrane	IBA
GO:0098719	Process	Sodium ion import across plasma membrane	IDA	1374913
GO:0098735	Process	Positive regulation of the force of heart contraction	IMP	15105296
GO:0098794	Component	Postsynapse	IBA
GO:1901660	Process	Calcium ion export	IDA	19481548
GO:1902532	Process	Negative regulation of intracellular signal transduction	ISS
GO:1903779	Process	Regulation of cardiac conduction	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS

Other IDs

• MIM: 182305
• HGNC: 11068
• e!Ensembl: ENSG00000183023

Protein

• UniProt ID: P32418
• Protein name: Sodium/calcium exchanger 1 (Na(+)/Ca(2+)-exchange protein 1) (Solute carrier family 8 member 1)
• Protein function: Mediates the exchange of one Ca(2+) ion against three to four Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes (PubMed:11241183, PubMed:1374913, P
• PDB: 8JP0, 8SGI, 8SGJ, 8SGT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01699	Na_Ca_ex	80 → 251	Sodium/calcium exchanger protein	Family
  PF16494	Na_Ca_ex_C	254 → 390	C-terminal extension of sodium/calcium exchanger domain	Family
  PF03160	Calx-beta	396 → 496	Calx-beta domain	Domain
  PF03160	Calx-beta	527 → 627	Calx-beta domain	Domain
  PF01699	Na_Ca_ex	799 → 964	Sodium/calcium exchanger protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected primarily in heart and at lower levels in brain (PubMed:1374913). Expressed in cardiac sarcolemma, brain, kidney, liver, pancreas, skeletal muscle, placenta and lung (PubMed:1476165). {ECO:0000269|PubMed:1374913, ECO:0000269|P
• Sequence:

  MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
  LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
  ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
  IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
  FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
  ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
  RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
  NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGII
  DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
  TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
  EIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPV
  FRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESY
  EFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHF
  LTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF
  VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQF
  KVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIF
  FSSLEAYCHIKGF

• Sequence length: 973

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTI-GAD65 AUTOIMMUNE NEUROLOGICAL SYNDROMES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIAPICAL TISSUE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28256087		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28683437		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21382638	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21833492		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30135655		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29930735		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	29566126		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29705161		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28988887, 30618761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	29705161		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30471087		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	15148385	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27063557	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36251145	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	23069678, 24954474		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31706846		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27588478	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37566113	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30107170		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28676412		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20109173		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	10690880, 16756677, 28809777, 30007606, 30084690		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23069678		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21293012, 23069678, 23224883, 24954474, 25972164, 31073288		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28683437		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29970122		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34127021, 37438612	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28188930		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	25500693		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10898440, 12502568, 17178715, 21291388, 22406195, 23224875, 25336645, 28755400, 31281251		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28852106		★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	38255780	Associate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	16756677		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29735991		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31033900		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30386243		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28804970	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28804970	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28804970		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28256087		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36231119	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28486943		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27588478	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15785003, 23224895		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	15785003	Associate	★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	25168954		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	17192285	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	30087539		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24641279	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10898440	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10898440, 12502568, 17178715, 21291388, 22406195, 23224875, 25336645, 28755400, 31281251		★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	32330487	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	15785003, 19562039, 25168954	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15785003, 17872462, 23224892, 23224895, 28446801, 29518186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15785003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23224892		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	23224892		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38492610	Associate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28804970		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29500176		★☆☆☆☆ Found in Text Mining only
Loeys-Dietz Syndrome	Loeys-Dietz Syndrome	BEFREE	30614814		★☆☆☆☆ Found in Text Mining only
Low frequency deafness	Low-frequency hearing loss	BEFREE	30067559		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17192285	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26045217		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26045217		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31706846		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30686898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29930735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24858026		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12031969, 28899208		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28683437		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28683437	Associate	★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	31165925		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30386243		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	27879314, 28753597		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28753597	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	1517376		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	1517376		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36251145	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15148385	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37151882	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21897267, 28809777, 30849492		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28550085		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASDB_DG	23563609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	23563609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	35894157	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31033900		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26584285	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29930735		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29930735		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20861471	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	37566113	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29511557		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29941946, 30692508		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32899900, 38255780	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	25500693, 28852106		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33869627	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34588774	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28550085		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18722877		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	BEFREE	28529049		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	20888801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24858026		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39731939	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35599603	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	37966164	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	17347034	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	20888801		★☆☆☆☆ Found in Text Mining only