SLC7A5P2 (solute carrier family 7 member 5 pseudogene 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387254
Gene name Solute carrier family 7 member 5 pseudogene 2
Gene symbol SLC7A5P2
Synonyms (NCBI Gene)
IMAAMMAA
Chromosome 16
Chromosome location 16p12.2
miRNA miRNA information provided by mirtarbase database.
36 Show/Hide all (36)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT545329 hsa-miR-6771-3p PAR-CLIP 21572407
MIRT545330 hsa-miR-548at-5p PAR-CLIP 21572407
MIRT545328 hsa-miR-561-3p PAR-CLIP 21572407
MIRT495937 hsa-miR-29a-3p PAR-CLIP 22291592
MIRT495936 hsa-miR-29b-3p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
GO:0022857 Function Transmembrane transporter activity IEA
GO:0055085 Process Transmembrane transport IEA
GO:1902475 Process L-alpha-amino acid transmembrane transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 24951 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GIP4
Protein name Putative L-type amino acid transporter 1-like protein IMAA (hLAT1 3-transmembrane protein IMAA) (hLAT1 3TM IMAA) (hLAT1 3-transmembrane protein MMAA) (hLAT1 3TM MMAA)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13520 AA_permease_2 50 → 183 Amino acid permease Family
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood mononuclear cells and lymphoid and myeloid cell lines. {ECO:0000269|PubMed:12009310}.
Sequence 
MAGAGPKRRALAAPVAEEKEEAREKMMAAKRADGAAPAGEGEGVTLQGNITLLKGVAVIV
VAIMSSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LDVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHSVQ
LIVHQPTQVI
Sequence length 190
Interactions View interactions

No strongly related genes found yet for SLC7A5P2.

No additional diseases found yet through genes similar to SLC7A5P2.